Recombinant Mouse Cytochrome c oxidase subunit 6C (Cox6c)

Shipped with Ice Packs

In Stock

Cat. No.

BT2037248

Source

in vitro E.coli expression system

Synonyms

Cox6c; Cytochrome c oxidase subunit 6C; Cytochrome c oxidase polypeptide VIc

Quick Inquiry

Description

Biological Function and Regulation

Cox6c integrates into cytochrome c oxidase (COX), the terminal complex of the mitochondrial electron transport chain. Its roles include:

OXPHOS Regulation: Facilitates electron transfer to oxygen, generating ATP .
Apoptosis: Released during mitochondrial membrane disruption, triggering intrinsic apoptosis .
Tissue-Specific Expression: High in heart, bladder, and colon; downregulated in COPD-associated muscle damage .

Regulatory Mechanisms:

Transcriptional: Activated by PGC-1α via NRF-1 binding to its promoter .
Post-Translational: Inhibited by HIV-1 Tat protein and miR-4276 .
Splicing: DAZAP1 reduces pre-mRNA splicing efficiency, affecting mitochondrial energy .

Research Applications and Findings

Recombinant Cox6c is used in studies of mitochondrial dysfunction, disease models, and therapeutic development:

Table 1: Clinical and Experimental Applications

Application	Key Findings	Source
Muscle Injury	Cox6c mRNA peaks within 6 hours post-injury, aiding wound-stage estimation .
Diabetic Nephropathy	mRNA upregulated in glomerular cells, linked to telmisartan treatment effects .
Infectious Diseases	Silencing miR-4276 upregulates Cox6c during early influenza infection .
Cancer	Overexpression in prostate cancer; fusion with HMGIC in uterine leiomyoma .

Comparative Analysis of Recombinant Versions

Differences in production systems and tags influence functionality and suitability for assays:

Parameter	HEK293T (MYC/DDK-tag)	E. coli (His/GST-tag)
Molecular Mass	8.5 kDa	38.5 kDa
Tag Impact	Enhanced detection in ELISA/WB	Improved solubility in bacterial systems
Purity	>80%	>85%
Storage Buffer	Tris-HCl, 10% glycerol	PBS, 0.01% Sarcosyl, 1 mM DTT

Clinical and Diagnostic Potential

Cox6c serves as a biomarker and therapeutic target:

Mitochondrial Disorders: Altered expression linked to muscle wasting in COPD and diabetic nephropathy .
Infectious Diseases: Modulation in influenza infection suggests roles in apoptosis regulation .
Cancer: Upregulated in prostate cancer and uterine leiomyoma, driven by gene fusions (e.g., HMGIC-COX6C) .

Future Directions

Research priorities include:

Therapeutic Interventions: Targeting Cox6c splicing (e.g., DAZAP1 inhibitors) or miRNA regulation .
Biomarker Development: Validating Cox6c as a diagnostic marker for mitochondrial diseases .
Structural Studies: Elucidating interactions with COX subunits and regulatory proteins .

Product Specs

Form

Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.

Lead Time

Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.

Notes

Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.

Reconstitution

We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.

Shelf Life

The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Storage Condition

Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.

Tag Info

The tag type will be determined during the manufacturing process.

We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.

Synonyms

Cox6c; Cytochrome c oxidase subunit 6C; Cytochrome c oxidase polypeptide VIc

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

2-76

Protein Length

Full Length of Mature Protein

Species

Mus musculus (Mouse)

Target Names

Cox6c

Target Protein Sequence

SSGALLPKPQMRGLLAKRLRVHIAGAFIVALGVAAAYKFGVAEPRKKAYAEFYRNYDSMK DFEEMRKAGIFQSAK

Uniprot No.

Q9CPQ1

Target Background

Function

Cytochrome c oxidase subunit 6C (Cox6c) is a component of the cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain. This chain drives oxidative phosphorylation. The respiratory chain consists of three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work cooperatively to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase is the component of the respiratory chain responsible for catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Database Links

KEGG: mmu:12864

STRING: 10090.ENSMUSP00000014457

UniGene: Mm.548

Protein Families

Cytochrome c oxidase subunit 6c family

Subcellular Location

Mitochondrion inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Mouse Cytochrome c oxidase subunit 6C (Cox6c)

Description

Biological Function and Regulation

Regulatory Mechanisms:

Research Applications and Findings

Table 1: Clinical and Experimental Applications

Comparative Analysis of Recombinant Versions

Clinical and Diagnostic Potential

Future Directions

Product Specs

Target Background

Quick Inquiry

Category

Service