Recombinant Mouse Cytochrome P450 4V2 (Cyp4v2)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome P450 enzymes (CYPs) are a superfamily of monooxygenases that catalyze the oxidation of various substrates . These enzymes are vital in the metabolism of xenobiotics, including drugs, environmental pollutants, and natural compounds . They also play a role in the metabolism of endogenous compounds such as fatty acids . Recombinant Mouse Cytochrome P450 4V2 (Cyp4v2) is a specific isoform involved in fatty acid metabolism, particularly in the eye .

Characteristics of Cyp4v2

Cyp4v2 is a cytochrome P450 monooxygenase that participates in fatty acid metabolism within the eye . It catalyzes the $$\omega$$-hydroxylation of polyunsaturated fatty acids (PUFAs) . The CYP4 family, including CYP4V2, has genetic variants associated with various diseases; for instance, CYP4V2 variants are linked to ocular disease .

Mouse Models and Cyp4v2

Mouse models with modified CYP genes are valuable tools for studying in vivo metabolism, bioactivation, and the toxicity of different compounds . These models include Cyp-knockout mice, human CYP-transgenic mice, and CYP-humanized mice .

  • Cyp-Knockout Mice: These models help determine if P450s are involved in the metabolism of a substance and which specific P450 isoform is most important for certain experimental endpoints . For example, Cyp2e1-null mice have shown resistance to acetaminophen (APAP)-induced liver necrosis, demonstrating the role of Cyp2e1 in APAP metabolism and toxicity .

  • Human CYP-Transgenic Mice: These mice express human CYP genes and can be used to predict how humans will metabolize xenobiotics, including drugs .

  • CYP-Humanized Mice: These models are engineered to express human CYP enzymes, allowing for the study of human-specific drug metabolism, pharmacokinetics, and pharmacodynamics in vivo .

Research Applications

Studies utilizing genetically engineered mouse models have provided insight into P450 enzyme functions. For instance, research on Cyp1a2-null mice and Cyp2e1-null mice has elucidated the roles of Cyp1a2 and Cyp2e1 in the metabolism and toxicity of acetaminophen (APAP) . These studies have shown that Cyp2e1-null mice are resistant to APAP-induced liver necrosis, while APAP is hepatotoxic in Cyp1a2 mice .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Cyp4v2; Cyp4v3; Cytochrome P450 4V2; Docosahexaenoic acid omega-hydroxylase CYP4V2; Long-chain fatty acid omega-monooxygenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MLWLWLGLSGQKLLLWGAASAVSLAGATILISIFPMLVSYARKWQQMRSIPSVARAYPLV GHALYMKPNNAEFFQQLIYYTEEFRHLPIIKLWIGPVPLVALYKAENVEVILTSSKQIDK SFLYKFLQPWLGLGLLTSTGSKWRTRRKMLTPTFHFTILENFLDVMNEQANILVNKLEKH VNQEAFNCFFYITLCALDIICETAMGKNIGAQSNNDSEYVRTVYRMSDMIYRRMKMPWLW FDLWYLVFKEGRDHKRGLKCLHTFTNNVIAERVKERKAEEDWTGAGRGPIPSKNKRKAFL DLLLSVTDEEGNRLSQEDIREEVDTFMFEGHDTTAAAINWSLYLLGTNPEVQRKVDQELD EVFGRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARSLSEDCEVGGYKVTKGTEAI IIPYALHRDPRYFPDPEEFRPERFFPENSQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI LACILRQFWVESNQKREELGLAGDLILRPNNGIWIKLKRRHEDDP
Uniprot No.

Target Background

Function

Recombinant Mouse Cytochrome P450 4V2 (CYP4V2) is a monooxygenase enzyme involved in ocular fatty acid metabolism. It catalyzes the ω-hydroxylation of polyunsaturated fatty acids (PUFAs), including docosahexaenoate (DHA) and its precursor eicosapentaenoate (EPA), contributing to retinal PUFA homeostasis. CYP4V2 also ω-hydroxylates saturated fatty acids such as laurate, myristate, and palmitate, exhibiting higher catalytic efficiency with myristate, followed by laurate, and then palmitate (C14 > C12 > C16). The mechanism involves molecular oxygen incorporation, with one oxygen atom integrated into the substrate and the other reduced to water. This process utilizes two electrons provided by NADPH via cytochrome P450 reductase (CPR).

Gene References Into Functions
  1. Studies indicate that within the mouse F11, Klkb1, and Cyp4v3 gene cluster, F11 and Cyp4v3 often exhibit parallel transcriptional responses, suggesting shared regulatory elements. PMID: 24066149
Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and key characteristics of mouse CYP4V2?

Mouse CYP4V2 is a membrane-bound cytochrome P450 enzyme with a full length of 525 amino acids. The protein contains a heme prosthetic group essential for its catalytic activity. According to the UniProt database (Entry: Q9DBW0), mouse CYP4V2 shares significant homology with human CYP4V2, though with species-specific differences . The protein is primarily localized in the endoplasmic reticulum, consistent with most cytochrome P450 enzymes, and functions as a monooxygenase.

What are the primary substrates for mouse CYP4V2?

Mouse CYP4V2 primarily catalyzes the omega-hydroxylation of polyunsaturated fatty acids (PUFAs), including docosahexaenoic acid (DHA) and eicosapentaenoic acid (EPA). Research indicates that CYP4V2 plays a crucial role in maintaining the homeostasis of these retinal PUFAs . Studies using recombinant enzymes have also demonstrated activity toward other substrates, including lauric acid and certain luciferin derivatives like luciferin-BE and luciferin-3FEME, which can be useful for designing enzyme activity assays .

How does mouse CYP4V2 compare to human CYP4V2?

While mouse and human CYP4V2 share substantial sequence homology, there are important structural and functional differences:

FeatureMouse CYP4V2Human CYP4V2
UniProt IDQ9DBW0Q6ZWL3
Length525 amino acids525 amino acids
Gene ID102294285440
Primary expressionLiver, eyeRetinal pigment epithelium, kidney
Key substratesPUFAs, including DHA and EPAPUFAs, including DHA and EPA
Disease relevanceLess characterizedMutations cause Bietti Crystalline Dystrophy

Despite these differences, mouse models are valuable for studying CYP4V2 function, as the fundamental enzymatic mechanisms appear to be conserved between species .

What expression systems are optimal for producing recombinant mouse CYP4V2?

Several expression systems have been successfully used to produce recombinant mouse CYP4V2:

E. coli expression system: Offers high yield but may require optimization of codon usage and addition of chaperones to ensure proper folding of the membrane protein. For functional studies, co-expression with NADPH-cytochrome P450 reductase (CPR) is essential .

Yeast expression system: Both Saccharomyces cerevisiae and Schizosaccharomyces pombe have been used successfully. The recombinant fission yeast strain RAJ232 that coexpresses human CYP4V2 and CPR has been effective for enzyme activity studies, and similar approaches can be applied for mouse CYP4V2 .

Mammalian cell lines: HEK293 and ARPE19 cells have been used for expression of human CYP4V2 and would likely be suitable for mouse CYP4V2 as well, particularly when studying protein-protein interactions or post-translational modifications .

The choice of expression system should be guided by the specific research question, with consideration for protein folding, post-translational modifications, and functional requirements.

How can the enzymatic activity of recombinant mouse CYP4V2 be measured?

Several methodological approaches can be used to assess CYP4V2 enzymatic activity:

Fatty acid hydroxylation assay: This direct approach measures the conversion of fatty acid substrates (e.g., DHA, EPA, or lauric acid) to their hydroxylated products using LC-MS/MS .

Luminogenic substrate assay: A convenient alternative using proluciferin substrates like luciferin-BE and luciferin-3FEME. The CYP4V2 enzyme converts these substrates to luciferin, which can then be detected through a luciferase reaction producing luminescence. This method offers high sensitivity and throughput for inhibitor screening .

Arachidonic acid hydroxylation assay: Similar to the approach used for CYP4F2, this assay measures the production of 20-HETE from arachidonic acid, providing insights into enzyme kinetics and inhibitor effects .

When designing activity assays, researchers should consider:

  • The need for NADPH regenerating systems (NADPH, glucose-6-phosphate, glucose-6-phosphate dehydrogenase)

  • Buffer composition and pH optimization

  • Detergent concentration for solubilization of the membrane-bound enzyme

  • Appropriate positive and negative controls

What are the recommended approaches for inhibitor screening against mouse CYP4V2?

A systematic approach for CYP4V2 inhibitor screening involves multiple stages:

  • Primary screening: Use the luciferin-3FEME assay to identify potential inhibitors at a fixed concentration (e.g., 10 μM). The luminogenic assay allows for high-throughput screening .

  • IC50 determination: For compounds showing significant inhibition, determine IC50 values using dose-response curves. The reported IC50 for the known CYP4 inhibitor HET0016 against human CYP4V2 is 179 nM, which provides a useful reference point .

  • Mechanism of inhibition studies: Determine Ki values and the type of inhibition (competitive, non-competitive, uncompetitive, or mixed) using varying substrate concentrations .

  • Time-dependent inhibition assessment: Evaluate whether inhibition increases with pre-incubation time, indicating potential irreversible or quasi-irreversible inhibition .

  • Selectivity profiling: Test inhibitors against other CYP enzymes to determine selectivity .

For CYP4V2, researchers should be aware that compounds showing selective inhibition against related enzymes like CYP4Z1 might not inhibit CYP4V2, highlighting the importance of structural differences in the active site .

How can CYP4V2 knockout mice be generated and validated?

Several approaches can be used to generate CYP4V2 knockout mice:

CRISPR/Cas9 genome editing: The most contemporary approach, involving design of guide RNAs targeting exons of the Cyp4v2 gene, followed by microinjection into zygotes. This method allows for precise gene editing but requires careful design to avoid off-target effects .

Homologous recombination: A traditional approach using targeting vectors to replace or disrupt the Cyp4v2 gene in embryonic stem cells, followed by blastocyst injection and chimera production .

Conditional knockout strategies: Using Cre-loxP or similar systems to achieve tissue-specific or inducible deletion of Cyp4v2, particularly useful for studying tissue-specific functions .

Validation of knockout models should include:

  • Genotyping to confirm the intended genetic modification

  • mRNA expression analysis by RT-PCR or RNA-seq

  • Protein expression analysis by Western blot using validated antibodies

  • Enzymatic activity assays using tissue microsomes

  • Phenotypic characterization, particularly focusing on retinal structure and function

What are the key phenotypes observed in CYP4V2-deficient mice?

Based on the role of CYP4V2 in humans and limited mouse model data, researchers should examine the following phenotypes in CYP4V2-deficient mice:

Ocular phenotypes: Given the association of CYP4V2 mutations with Bietti crystalline dystrophy in humans, careful examination of the retina is essential, looking for:

  • Crystal deposits in the retina

  • Changes in retinal pigment epithelium

  • Alterations in electroretinogram (ERG) responses

  • Progressive retinal degeneration

  • Changes in choroidal vasculature

Metabolic phenotypes: Since CYP4V2 is involved in fatty acid metabolism:

  • Alterations in lipid profiles, particularly PUFAs

  • Potential changes in membrane composition of retinal cells

  • Possible systemic metabolic effects

Gene expression changes: Compensatory regulation of other CYP4 family members or genes involved in fatty acid metabolism

How can humanized CYP4V2 mouse models be generated and utilized?

Humanized CYP4V2 mice, where the mouse Cyp4v2 gene is replaced with human CYP4V2, can be valuable for studying human-specific functions and therapeutic development:

Generation approaches:

  • Replace the entire mouse Cyp4v2 coding region with human CYP4V2 cDNA using homologous recombination or CRISPR/Cas9

  • For expression studies, bacterial artificial chromosome (BAC) transgenic approaches can maintain human regulatory elements

  • To study specific mutations, introduce disease-associated human CYP4V2 variants

Research applications:

  • Testing gene therapy approaches, such as AAV-mediated delivery of CYP4V2

  • Evaluating human-specific inhibitors or drugs targeting CYP4V2

  • Studying human disease mutations in an in vivo context

  • Pharmacological studies relevant to human drug metabolism

When designing humanized models, researchers should consider codon optimization of the human gene for improved expression in mice, as demonstrated for AAV-mediated expression of human CYP4V2 .

How does CYP4V2 dysfunction contribute to retinal diseases, and how can this be modeled?

CYP4V2 mutations cause Bietti crystalline dystrophy (BCD), a progressive retinal degeneration characterized by crystalline deposits in the retina. The disease mechanism involves:

  • Disrupted fatty acid metabolism: Impaired omega-hydroxylation of PUFAs leads to accumulation of abnormal lipid products in the retinal pigment epithelium (RPE) .

  • Structural effects of mutations: CYP4V2 mutations (especially missense) impact:

    • The transmembrane domain by altering hydrogen bonds

    • Distortion of alpha helices

    • Positioning of the heme group and catalytic site

    • Reduced lauric acid oxidation capacity (20-30% reduction for variants like H331P and G410C)

To model these disease mechanisms, researchers can:

  • Create knock-in mice carrying specific human disease mutations

  • Use CRISPR/Cas9 to introduce equivalent mutations in the mouse Cyp4v2 gene

  • Generate patient-derived iPSCs and differentiate them into RPE cells for in vitro studies

  • Develop AAV-mediated expression models of mutant CYP4V2 in wild-type or Cyp4v2-null backgrounds

What approaches show promise for gene therapy targeting CYP4V2-related diseases?

AAV-mediated gene therapy shows significant promise for treating CYP4V2-related diseases like BCD:

Vector optimization: Research shows that AAV2 vectors encoding codon-optimized CYP4V2 (AAV2.coCYP4V2) result in higher protein expression and enzyme activity than vectors encoding wild-type CYP4V2 (AAV2.wtCYP4V2) in multiple cell types, including:

  • HEK293 cells

  • ARPE19 cells

  • Patient iPSC-derived RPE cells

  • Human RPE/choroid explants

Preclinical validation strategies:

  • First demonstrate expression and activity in cell culture systems

  • Progress to ex vivo human RPE explants or organoids

  • Test in appropriate animal models (e.g., Cyp4v2-null mice)

  • Assess both efficacy (CYP4V2 expression and activity) and safety parameters

Key considerations for gene therapy development:

  • Promoter selection for optimal RPE expression

  • AAV serotype selection for efficient transduction of target cells

  • Codon optimization strategies to enhance expression

  • Dose-response studies to determine optimal viral titers

  • Long-term expression studies to assess durability

How can structure-based drug design be applied to develop selective modulators of CYP4V2?

Rational design of CYP4V2 modulators can be approached through:

Homology modeling: In the absence of a crystal structure, homology models of CYP4V2 can be developed based on related CYP structures. Research has shown successful modeling using:

  • I-TASSER recommended structural analogs

  • Heme cofactor coordinates inserted from template structures

  • Covalent binding between the 5-methyl of the heme moiety and conserved glutamate residues (e.g., Glu329)

  • Energy minimization in the OPLS-AA force field

Docking studies: Molecular docking can identify potential binding modes and interactions of candidate compounds:

  • The Genetic Optimization for Ligand Docking (GOLD) suite has been used successfully

  • The GoldScore P450 scoring function can evaluate docking poses

  • The heme iron and surrounding space (within 18 Å radius) should be defined as the docking site

  • Energy minimization of poses in the presence of the CYP4V2 homology model helps identify plausible binding modes

Structure-activity relationship studies: Systematic modification of lead compounds and testing against recombinant CYP4V2 can identify key pharmacophore features for potency and selectivity.

Key challenges:

  • Limited structural information on CYP4V2

  • Need to achieve selectivity against other CYP4 family members

  • Balancing potency with physicochemical properties suitable for reaching the target tissue (RPE)

What are the critical factors for maintaining stability and activity of recombinant mouse CYP4V2?

Recombinant CYP4V2 requires careful handling to maintain stability and activity:

Storage conditions:

  • Store lyophilized protein at -20°C/-80°C

  • For reconstituted protein, add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

Reconstitution protocol:

  • Centrifuge vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • For buffer selection, Tris/PBS-based buffer at pH 8.0 with 6% trehalose has been shown to maintain stability

Activity preservation:

  • Always include NADPH-regenerating system in activity assays

  • Work aliquots can be stored at 4°C for up to one week

  • Monitor heme content spectrophotometrically (A417/A280 ratio) to ensure integrity of the holoenzyme

How should researchers interpret apparent contradictions in CYP4V2 substrate specificity data?

Researchers may encounter contradictory data regarding CYP4V2 substrate specificity due to several factors:

Expression system variations: Different expression systems (E. coli, yeast, mammalian cells) can yield CYP4V2 with varying post-translational modifications and folding patterns, affecting activity profiles .

Assay conditions: Variations in buffer composition, pH, detergent concentration, and NADPH-regenerating systems can significantly impact substrate conversion rates .

Species differences: Mouse and human CYP4V2, despite high sequence homology, may exhibit different substrate preferences .

Membrane environment: The lipid composition of membranes used for reconstitution can affect enzyme conformation and substrate access .

To resolve contradictions:

  • Carefully compare experimental conditions between studies

  • Perform direct comparisons of mouse and human enzymes under identical conditions

  • Use multiple substrate classes to build a comprehensive profile

  • Consider the presence of CPR and its ratio to CYP4V2 in different systems

  • Validate findings with multiple methodological approaches

What are the most sensitive detection methods for measuring low concentrations of mouse CYP4V2 in biological samples?

Several high-sensitivity methods are available for detecting and quantifying mouse CYP4V2:

Enzyme-Linked Immunosorbent Assay (ELISA):

  • Commercial sandwich ELISA kits can detect mouse CYP4V2 with sensitivity <0.07 ng/mL

  • Suitable for tissue homogenates, cell lysates, and biological fluids

  • Typical detection range: 0.156-10 ng/mL

Western Blot with enhanced chemiluminescence:

  • Using validated antibodies (such as Proteintech 13826-1-AP)

  • Enhanced chemiluminescence substrates can improve sensitivity

  • Typical dilution range: 1:1000-1:8000

Immunohistochemistry with amplification:

  • Tyramide signal amplification can enhance detection in tissue sections

  • Particularly useful for localizing CYP4V2 in specific cell types

Mass Spectrometry:

  • Targeted proteomics approaches like Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM)

  • Can detect CYP4V2-specific peptides in complex samples

  • Allows absolute quantification when using stable isotope-labeled standards

For optimal results, researchers should:

  • Include appropriate positive controls (e.g., liver tissue for mouse CYP4V2)

  • Perform spike-recovery experiments to validate detection in specific sample types

  • Consider sample preparation techniques that may concentrate the target protein

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.