Recombinant Mouse D (2) dopamine receptor (Drd2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, customers can request a specific tag type; we will prioritize fulfilling such requests.
Synonyms
Drd2; D(2 dopamine receptor; Dopamine D2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDPLNLSWYDDDLERQNWSRPFNGSEGKPDRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS AVNPIIYTTFNIEFRKAFMKILHC
Uniprot No.

Target Background

Function
The dopamine D2 receptor is a G protein-coupled receptor that inhibits adenylyl cyclase. It positively regulates postnatal regression of retinal hyaloid vessels by suppressing VEGFR2/KDR activity downstream of OPN5.
Gene References Into Functions
  1. Impaired recruitment of dopamine neurons during working memory was observed in mice with striatal D2 receptor overexpression. PMID: 30026489
  2. Loss-of-function in D2 receptor-expressing striatal medium spiny neurons (D2-MSNs) within the ventrolateral striatum (VLS) reduces goal-directed behaviors. PMID: 28145402
  3. Dopamine 2 receptor upregulation is associated with obesity. PMID: 30254156
  4. This study assessed the behavioral effects of pharmacological manipulation and genetic blockade of A2A and D2 receptors within striatal heteromeric populations. PMID: 29053217
  5. DRD2 in primary mesencephalic neurons significantly regulated adipogenesis genes. PMID: 29595454
  6. Dopamine D2 receptor deletion from parvalbumin interneurons in mice impairs inhibitory activity in the ventral hippocampus, dysregulating the dopaminergic system and resulting in schizophrenia-like phenotypes. PMID: 29531031
  7. Acute cocaine administration reveals that the absence of D2L, but not D2S, strongly impairs motor and cellular responses, similar to the ablation of both isoforms. This suggests that under dopaminergic challenge, D2L signaling is crucial for controlling striatal circuits regulating motor activity. PMID: 29255027
  8. Paraventricular thalamus inhibition by D2Rs modulates cocaine sensitivity, which may have implications for human drug use. PMID: 29071300
  9. This study investigated the spatial distribution of D2 medium-sized spiny neurons across the striatum using D2-eGFP double transgenic mice. PMID: 28860974
  10. Pre- and postsynaptic colocalization of kappa opioid receptor and D2R supports a role for kappa opioid receptor potentiation of D2R inhibitory autoreceptor function and the inhibitory action of D2R on efferent medium spiny neurons. Kappa opioid receptor co-activation accelerates D2R sensitization by decreasing dopamine release in the nucleus accumbens. PMID: 28531297
  11. Social isolation induces schizophrenia-related deficits, and interactions between histidine triad nucleotide-binding protein 1, NMDA receptor 1, and dopamine receptor 2 may underlie these deficits. PMID: 28410269
  12. These results support intrastriatal connections of D2R(+)-MSNs (iMSNs) with dMSNs, indicating that D2R signaling in MSNs is critical for intrastriatal circuit function. PMID: 27671625
  13. Ventral tegmental area dopamine neurons promote wakefulness via D2/D3 receptors. PMID: 28124114
  14. Dopamine D2L isoform receptors and nucleus accumbens D2 receptor medium spiny neurons suppress the influence of previously correct behavioral strategies, allowing control to transfer to new strategies. PMID: 27317196
  15. D2 receptor (D2R) +/+ enriched environment (EE) mice lived longer than their deprived environment (DE) counterparts. PMID: 26992232
  16. The adenosine agonist 5'-N-ethylcarboxamidoadenosine, a known promoter of B cell proliferation, acted with DPD to increase B cell numbers. In humans, dopamine modulates B cell mass through DRD2 and inhibits adenosine signaling. PMID: 27373926
  17. Klf15 expression increases during neuropathic pain. TNF-alpha regulates Klf15 expression, which in turn regulates dopamine D2 receptor expression and neuropathic pain in mouse models. PMID: 28830816
  18. Mice lacking dopamine type 2 receptors (D2Rs) from pituitary lactotropes exhibit chronic high prolactin levels, increased body weight, increased fat depots and adipocyte size, elevated serum lipids, and a metabolic phenotype. PMID: 27802964
  19. Glycogen synthase kinase 3 requires dopamine D2-receptors and serotonin 5-HT1A-receptors for fine control of excitatory transmission. PMID: 27678414
  20. No differences in D2R binding were found following methamphetamine administration and withdrawal, suggesting that D2R alterations may not be involved in anxiety-related symptoms or psychomotor sensitization during withdrawal. PMID: 26896754
  21. Dopamine Receptor Signaling in MIN6 beta-Cells PMID: 27508444
  22. Reduced D2 receptor levels in obesity alter activity and energy expenditure, reducing behavioral energy expenditure. This suggests a fundamental role for dopamine in regulating behavioral energy expenditure. PMID: 26281715
  23. D2R agonist treatment blocks tumor growth, induces regression of aberrant blood supply, and normalizes blood vessels. Combined anti-VEGF therapy suppresses intratumoral hemorrhage and restores blood vessel perfusion. PMID: 28152577
  24. DRD2 activation alleviates CIA symptoms by ameliorating Th17/Treg imbalance. PMID: 26693483
  25. Chronic social defeat stress increased DRD2 dimer expression in the prefrontal cortex of susceptible and unsusceptible mice. PMID: 26484605
  26. Lamotrigine, lithium, and valproate exert behavioral effects by disrupting beta-arrestin 2-mediated regulation of Akt/GSK3 signaling by D2 dopamine receptors. PMID: 26459714
  27. D2S, but not D2L receptors, exhibited calcium-dependent desensitization similar to endogenous autoreceptors. PMID: 26308580
  28. D2R controls renal inflammation by modulating the Akt pathway through effects on PP2A activity/expression. PMID: 26290374
  29. Low DRD2 autoreceptor levels enhance the salience of cocaine-paired cues, contributing to vulnerability for cocaine use and relapse. PMID: 25547712
  30. D2R-expressing cells constitute a subpopulation of GABAergic hippocampal interneurons in addition to glutamatergic hilar mossy cells. PMID: 25545461
  31. Cerebral ischemia induced D2R expression on Iba1-immunoreactive inflammatory cells. PMID: 26104289
  32. Dopamine D2 receptor upregulation in the nucleus accumbens leads to hyperactivity. PMID: 25578797
  33. Investigating cAMP-dependent protein kinase A (PKA) signaling in D2 receptor-expressing indirect pathway medium-sized spiny neurons (iMSNs) may improve understanding of psychiatric disorders. PMID: 26305972
  34. Heterozygous Reelin mutant mice showed increased DRD2 and Htr2a expression in striatum membranes and decreased expression in frontal cortex membranes compared to wild-type. PMID: 25637489
  35. Basal dopamine release in the basolateral amygdala increases respiratory rates through post-synaptic D2-like receptors, potentially associated with emotional responses. PMID: 25281921
  36. Presynaptic D2Rs in hippocampal dopamine fibers modulate long-term depression expression and regulate hippocampal learning and memory. PMID: 24742619
  37. Dopamine signaling modulates interneuron number and emotional behavior; developmental D2 receptor loss or blockade may be a mechanism for neuropsychiatric disorders. PMID: 25393953
  38. D2 receptor isoforms function as both postsynaptic receptors and autoreceptors. PMID: 23811070
  39. Beta-arrestin-biased D2R potentiated amphetamine-induced locomotion, while G protein-biased D2R had minimal effects. PMID: 25964346
  40. D2 receptors play a role in activity-dependent functional development of the mouse retina. PMID: 25393815
  41. Striatal dopamine D2 receptor activity alters ventral tegmental area dopamine neuron firing patterns. PMID: 25675529
  42. Endocrine-mediated D2R actions on sexual dimorphic liver gene expression may be relevant during chronic dopaminergic medication in psychiatric disease. PMID: 25545383
  43. Hippocampal Drd2 expression in wild-type mice is limited to glutamatergic hilar mossy cells. Quinpirole activation increases hilar mossy cell excitability via the Akt/GSK pathway, blocked by raclopride. PMID: 24753432
  44. Hippocampal D2 receptors are important for place response stability; D2R-KO mice showed place-cell properties similar to aged animals, suggesting D2R alterations contribute to age-related place-cell changes. PMID: 24747614
  45. Sestrin2 expression is upregulated by dopamine D2 receptor. PMID: 25024286
  46. D2 receptor activation enhances reward system activity in methamphetamine dependence. PMID: 24748435
  47. Collagen glycation disrupts DDR2 binding and activation, potentially explaining diminished lysyl oxidase levels and low cross-links in diabetic bone. PMID: 24120383
  48. D2R- and noradrenaline receptor-mediated transmission time courses reflect differences in inhibitory postsynaptic potential (IPSP) spillover and pooling. PMID: 24872568
  49. D2R activation decreases huntingtin phosphorylation at its Akt site. PMID: 24619418
  50. Silencing ventral tegmental area dopaminergic neurons is necessary for inducing aversive responses and learning through nucleus accumbens dopamine D2 receptors. PMID: 24737889
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in retinal hyaloid vessels at postnatal day 6.; [Isoform 1]: Expressed in the pituitary gland, stratum, brain stem and cortex.; [Isoform 2]: Expressed in the brain stem.

Q&A

What are the major isoforms of mouse D2 dopamine receptor and how are they distributed?

The mouse D2 dopamine receptor exists in two major forms generated by alternative splicing of the same gene. The larger form (D2L) is generally more abundant throughout most brain regions, while the shorter form (D2S) predominates in the brain stem . This differential distribution has functional implications, as the D2L isoform appears to serve primarily as a heteroreceptor within the striatum, while the D2S isoform functions more prominently as an autoreceptor on dopaminergic neurons . Understanding this distribution is crucial when designing experiments targeting specific D2 receptor populations.

What is the functional difference between D2 autoreceptors and heteroreceptors?

D2 autoreceptors are expressed on dopaminergic neurons themselves and function to regulate dopamine synthesis, release, and neuronal firing through inhibitory feedback mechanisms. These Gi/o-coupled inhibitory receptors are found at both somatodendritic and axonal sites . In contrast, D2 heteroreceptors are expressed on non-dopaminergic neurons that receive dopaminergic input. While both receptor types couple to similar signaling pathways, their location and the cellular context in which they function result in distinct physiological outcomes. Autoreceptors primarily regulate dopamine transmission through feedback inhibition, while heteroreceptors mediate the postsynaptic effects of dopamine on target neurons .

How do I confirm successful expression of recombinant mouse Drd2 in cell culture systems?

To confirm successful expression of recombinant mouse Drd2, multiple complementary approaches should be employed:

  • Radioligand binding assays: Membranes from transfected cells can be tested for their ability to bind selective D2 receptor ligands such as [³H]spiperone, which binds with high affinity to both forms of the D2 receptor .

  • Functional assays: Since D2 receptors couple to Gi/o proteins, measuring inhibition of adenylyl cyclase activity or changes in downstream signaling events (e.g., MAPK activation, calcium mobilization) following agonist administration can confirm functional expression.

  • Immunocytochemistry or Western blotting: Using antibodies specific to mouse D2 receptors can provide visual confirmation of expression and information about subcellular localization.

  • Real-time PCR: Verification of mRNA expression can confirm successful transfection before proceeding to protein-level analyses.

What are the key considerations when designing a conditional Drd2 knockout mouse model?

When designing a conditional Drd2 knockout mouse model, researchers should consider:

  • Strategic placement of LoxP sites: The placement should allow efficient excision of critical exons while minimizing disruption of neighboring genes. In established models, LoxP sites typically flank exon 2 of the Drd2 gene .

  • Cre-driver selection: Choose a Cre driver with appropriate spatial and temporal specificity. For dopamine neuron-specific deletion, a DAT-Cre line (where Cre expression is driven by the dopamine transporter promoter) is commonly used .

  • Breeding strategy: A typical breeding scheme involves crossing mice homozygous for the floxed Drd2 allele (Drd2^tm1.1Mrub/J) with mice hemizygous for the Cre recombinase expressed under the control of the dopamine transporter gene (Slc6a3) .

  • Confirmation of deletion: Validate the conditional knockout through methods such as real-time PCR, immunohistochemistry, and functional assays to confirm the absence of D2 receptors in the targeted cell population while maintaining normal expression elsewhere .

  • Control selection: Appropriate controls should include Cre-negative littermates that are homozygous for the floxed Drd2 allele to account for potential effects of the loxP sites themselves .

How can I distinguish between the effects of D2 autoreceptors versus heteroreceptors in behavioral studies?

Distinguishing between D2 autoreceptor and heteroreceptor effects requires specialized approaches:

What methodological approaches are recommended for measuring D2 receptor binding and expression in mouse brain tissue?

For comprehensive analysis of D2 receptor binding and expression:

  • Receptor autoradiography: Using selective radioligands such as 125I-epidepride enables quantitative mapping of D2 receptor density across brain regions. This approach can reveal approximately 2-fold variations in receptor binding across different mouse strains in key regions such as the nucleus accumbens core, shell, and dorsomedial caudate-putamen .

  • mRNA expression analysis: Techniques such as in situ hybridization or Affymetrix oligoarray systems can quantify Drd2 mRNA levels, with studies reporting 1.5- to 2-fold variations in expression among different mouse strains .

  • Protein quantification: Western blotting or ELISA using D2-specific antibodies can provide quantitative measures of receptor protein levels.

  • Immunohistochemistry: Combining with tyrosine hydroxylase (TH) staining can help identify D2 autoreceptors on dopaminergic neurons versus heteroreceptors on other cells .

  • Single-cell RT-PCR: This approach can determine cell-specific expression patterns, particularly useful for distinguishing D2S versus D2L isoform expression in identified neurons.

Brain RegionApproximate Range of D2 Receptor Binding VariationHeritability (h²)
NAc Core2-fold~0.35
NAc Shell2-fold~0.35
Dorsomedial CPu2-fold~0.35
Forebrain Drd2 Expression1.5- to 2-fold0.47

How do I address conflicting results between behavioral and molecular data in Drd2 studies?

When facing conflicting results between behavioral and molecular data:

  • Consider technical factors: Different methodologies for measuring receptor binding, expression, or function may yield inconsistent results. Verify the specificity and sensitivity of each assay and consider complementary approaches.

  • Examine strain differences: Significant variations in D2 receptor binding and expression exist across mouse strains, with heritability values of approximately 0.35 for receptor binding and 0.47 for expression . These genetic differences can influence behavioral and molecular outcomes.

  • Evaluate developmental compensation: Particularly in knockout models, compensatory changes in other dopamine receptor subtypes or downstream signaling pathways may occur during development, potentially explaining discrepancies between molecular alterations and behavioral phenotypes.

  • Consider region-specific effects: D2 receptors in different brain regions may mediate distinct behavioral outcomes. Regional analysis of molecular changes may resolve apparent conflicts with behavioral data.

  • Assess dose-dependency: The relationship between molecular changes and behavioral outcomes may be non-linear. For example, studies have found significant correlations between D2 receptor binding and low-dose (1.33 g/kg) ethanol stimulant response, but not with ethanol preference .

What are the implications of the differential distribution of Drd2 isoforms for interpreting knockout studies?

The differential distribution of D2 receptor isoforms presents several interpretive challenges:

  • Compensatory upregulation: Studies with D2L knockout mice reveal upregulation of D2S, which can maintain autoreceptor function despite the loss of D2L. This compensatory mechanism explains why D2L knockout mice still exhibit autoreceptor-mediated hyperpolarization of dopamine soma and inhibition of dopamine release .

  • Region-specific effects: As the larger D2L form predominates in most brain regions while D2S is more abundant in the brainstem , knockout effects may vary regionally. Careful region-specific analysis is essential to accurately interpret phenotypes.

  • Functional redundancy: Despite preferential roles (D2L as heteroreceptor, D2S as autoreceptor), both isoforms can partially substitute for each other. D2L knockout mice still show quinpirole-mediated inhibition of locomotor activity and D2-receptor mediated inhibition of tyrosine hydroxylase activity .

  • Cell-type specific effects: The predominance of D2L in medium spiny neurons versus D2S on dopamine terminals means that global knockout phenotypes reflect a complex mixture of effects across various cell types. Cell-specific knockout approaches provide clearer interpretations.

  • Isoform-specific signaling: The two D2 isoforms may couple differently to various signaling pathways, complicating the interpretation of molecular and behavioral data from knockout models.

How can recombinant mouse Drd2 models contribute to understanding psychiatric disorders and addiction?

Recombinant mouse Drd2 models offer valuable insights into psychiatric disorders and addiction:

  • Conditional autoreceptor knockouts: D2 autoreceptor-null mice show hyperactivity and increased sensitivity to cocaine, supporting the role of autoreceptors in regulating locomotor and reward-driven behaviors . These models help disentangle pre- and postsynaptic D2 receptor functions in addiction circuits.

  • Behavioral inhibition studies: AutoDrd2-KO mice demonstrate impaired reversal learning and difficulty sustaining prolonged responses, suggesting a role for D2 autoreceptors in behavioral inhibition mechanisms relevant to impulsivity disorders like ADHD .

  • Genetic correlation studies: Research in BXD recombinant inbred mouse strains reveals significant correlations between D2 receptor binding and ethanol stimulant response, and between Drd2 expression and conditioned place preference. These findings suggest that ethanol preference and CPP are associated with the expression of Drd2 or closely linked genetic loci .

  • Pharmacogenetic investigations: By combining recombinant Drd2 models with drug administration, researchers can investigate how genetic variations in D2 receptor function modulate responses to antipsychotics, stimulants, and other psychiatric medications.

  • Disease modeling: Recombinant Drd2 models can be crossed with other genetic models of psychiatric disorders to investigate the contribution of D2 receptor dysfunction to complex disease phenotypes.

What are the methodological considerations for studying Drd2 polymorphisms and their functional impacts?

When investigating Drd2 polymorphisms:

  • Polymorphism selection: Focus on functionally relevant polymorphisms. In human studies, several key polymorphisms have been identified (Taq1A, C957T, and -141C ins/del) , which may guide the selection of homologous regions in mouse models.

  • Genotyping approaches: For detection of polymorphisms, methods such as restriction fragment length polymorphism (RFLP) analysis can be used for polymorphisms like Taq1A and -141C ins/del, while direct sequencing is preferred for variants like C957T .

  • Sample size considerations: Ensure adequate statistical power. Studies with small sample sizes may fail to detect associations between polymorphisms and phenotypes. For example, some human studies found no association between DRD2 polymorphisms and major depressive disorder, possibly due to limited sample sizes .

  • Population stratification: Control for genetic background effects. The distribution of Drd2 polymorphisms varies across populations, necessitating careful matching of experimental and control groups.

  • Functional validation: Beyond identification of polymorphisms, assess their functional impact using approaches such as:

    • In vitro expression studies to measure receptor levels and function

    • Electrophysiological recordings to assess neuronal responses

    • PET imaging to measure in vivo receptor availability

    • Behavioral assessments to determine phenotypic consequences

How can I integrate Drd2 receptor studies with dopamine transporter research for a more comprehensive understanding of dopaminergic function?

Integrating Drd2 receptor and dopamine transporter research:

  • Dual genetic manipulation: Utilize breeding schemes that combine Drd2 conditional alleles with dopamine transporter (DAT) Cre-recombinase expression systems. This approach not only provides cell-specific deletion of D2 autoreceptors but also enables investigation of the functional interplay between D2 receptors and DAT .

  • Co-expression analysis: Examine the co-localization and co-regulation of D2 receptors and DAT in dopaminergic neurons using techniques such as fluorescent in situ hybridization, immunohistochemistry, or single-cell RNA sequencing.

  • Functional interaction studies: Investigate how D2 receptor activation modulates DAT function and vice versa through:

    • In vivo voltammetry to measure dopamine release and uptake kinetics

    • Radioligand binding to assess how D2 receptor activation affects DAT surface expression and function

    • Behavioral studies comparing the effects of D2 and DAT manipulations

  • Pharmacological approaches: Use selective D2 receptor and DAT ligands in combination to dissect their relative contributions to dopaminergic signaling and behavior.

  • Systems biology approaches: Employ computational modeling to integrate data on D2 receptor and DAT function, providing a more comprehensive understanding of dopamine homeostasis and how it is disrupted in various pathological conditions.

What are the common pitfalls in generating and validating Drd2 conditional knockout models?

Common pitfalls and their solutions include:

  • Incomplete recombination: Cre efficiency can vary, leading to incomplete deletion of the floxed Drd2 gene. Solution: Thoroughly validate recombination efficiency through PCR, immunohistochemistry, and functional assays before interpreting phenotypic data .

  • Off-target effects: Cre expression may occur in unintended cell populations. Solution: Characterize the expression pattern of the Cre driver line thoroughly and consider using inducible Cre systems to minimize developmental effects.

  • Compensatory mechanisms: Deletion of D2 autoreceptors may lead to compensatory changes in other aspects of dopamine signaling. Solution: Examine multiple components of the dopamine system, including other receptor subtypes, synthetic enzymes, and transporters.

  • Strain background effects: The phenotypic consequences of Drd2 deletion can be influenced by genetic background. Solution: Backcross to a uniform genetic background or use littermate controls to minimize these effects.

  • Developmental versus acute effects: Constitutive knockout models cannot distinguish between developmental and acute roles of D2 receptors. Solution: Consider using tamoxifen-inducible Cre systems for temporal control of gene deletion.

How do I optimize experimental parameters for studying Drd2 function in ex vivo preparations?

For optimizing ex vivo studies of Drd2 function:

  • Tissue preparation: Brain slice preparation must preserve the integrity of dopaminergic circuits. For midbrain dopamine neurons, horizontal or coronal slices (250-300 μm) cut in ice-cold, oxygenated solution with reduced sodium and calcium are recommended.

  • Recording conditions: Maintain slices at physiological temperature (32-34°C) in oxygenated artificial cerebrospinal fluid. For studying D2 autoreceptor-mediated inhibition of firing, include antagonists of glutamatergic and GABAergic transmission to isolate intrinsic properties.

  • Pharmacological tools: Select appropriate D2 receptor agonists (e.g., quinpirole) and antagonists (e.g., sulpiride) at concentrations that maintain receptor specificity. For studying autoreceptor function specifically, consider low concentrations of agonists that preferentially activate high-affinity autoreceptors.

  • Experimental readouts:

    • Electrophysiology: Whole-cell patch-clamp recordings can measure D2-mediated hyperpolarization or changes in firing rate

    • Fast-scan cyclic voltammetry: Monitors dopamine release and uptake dynamics

    • Calcium imaging: Assesses D2-mediated modulation of neuronal activity across populations

  • Verification: Confirm the D2 receptor specificity of observed effects using knockout tissues or selective antagonists.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.