Recombinant Mouse D (3) dopamine receptor (Drd3)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methods

The recombinant Drd3 is synthesized through bacterial expression, leveraging engineered plasmids containing the DRD3 gene fused to affinity tags (e.g., His/GST). The workflow involves:

  1. Expression: Induction of E. coli cultures to produce the recombinant protein.

  2. Purification: Affinity chromatography (e.g., nickel-NTA or GST columns) to isolate tagged Drd3.

  3. Validation: SDS-PAGE and Western blotting to confirm purity and integrity .

Applications in Research

Recombinant Drd3 is instrumental in studying dopamine signaling, receptor interactions, and disease mechanisms. Key applications include:

Ligand Binding and Pharmacological Profiling

Drd3 exhibits high affinity for dopamine and selective agonists/antagonists . Recombinant Drd3 is used to:

  • Test Ligand Specificity: Evaluate binding kinetics of agonists (e.g., 7-OH-DPAT, pramipexole) and antagonists (e.g., SB-277011-A) .

  • Study Receptor Dimerization: Investigate interactions with other dopamine receptors (D1/D2) in heteromeric complexes .

Signal Transduction Studies

Drd3 inhibits adenylyl cyclase via Gi/o proteins, modulating cAMP levels. Recombinant Drd3 helps elucidate:

  • Downstream Effectors: GIRK channels, MAPK pathways, and transcriptional regulators .

  • Modulation by Allosteric Regulators: Investigate compounds that enhance or inhibit Drd3 signaling .

Neuroinflammation and Neurodegeneration

Drd3 is expressed in CD4+ T-cells and neurons, influencing Parkinson’s disease (PD) progression . Recombinant Drd3 aids in:

  • Modeling T-Cell Receptor Signaling: Assess how Drd3 antagonists (e.g., PG01037) reduce neuroinflammation in PD models .

  • Studying α-Synuclein Pathology: Explore Drd3’s role in mitigating α-synuclein aggregation and neurotoxicity .

Expression Patterns

Recombinant Drd3 studies reveal region-specific expression in:

  • Brain: Limbic regions (nucleus accumbens, olfactory tubercle) and midbrain dopaminergic neurons .

  • Immune Cells: CD4+ T-cells, where Drd3 modulates Th1/Th17 differentiation and neuroinflammation .

Clinical Relevance

  • Parkinson’s Disease: Drd3 antagonism in CD4+ T-cells reduces motor impairment and neurodegeneration in MPTP models .

  • Schizophrenia and Addiction: Drd3 antagonists (e.g., SB-277011-A) show antipsychotic potential by modulating sensorimotor gating .

  • Depression: Drd3 agonists (e.g., pramipexole) exhibit antidepressant effects in preclinical models .

Tools and Reagents for Drd3 Research

ToolApplication
Anti-Drd3 AntibodiesWestern blot, immunoprecipitation, and immunocytochemistry (e.g., ab42114)
Agonists/AntagonistsFunctional assays (e.g., cAMP inhibition, ligand binding)
Recombinant Drd3Structural studies, ligand screening, and receptor signaling assays

Challenges and Future Directions

  • Structural Complexity: Drd3’s flexibility complicates crystallization for X-ray studies.

  • Therapeutic Translation: Selective Drd3 modulators require optimization for brain penetration and safety.

  • Immune-CNS Crosstalk: Further studies on Drd3’s role in T-cell-mediated neuroinflammation are critical for PD therapies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage condition, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a 6-month shelf life at -20°C/-80°C. Lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Drd3; D(3 dopamine receptor; Dopamine D3 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAPLSQISSHINSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYMVLRQRRRKRILTRQNSQCISIRPGFPQ QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKPYPQKCQDPLLSHLQPLSPGQTHGELK RYYSICQDTALRHPNFEGGGGMSQVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLKLGP LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV NSALNPVIYTTFNIEFRKAFLKILSC
Uniprot No.

Target Background

Function
The dopamine receptor D3 mediates its activity through G proteins, which inhibit adenylyl cyclase. It promotes cell proliferation.
Gene References Into Functions
  1. This study revealed that D3 receptor deficiency has sex-specific effects on wheel running activity during training and plateau phases. PMID: 28684358
  2. The dopamine D3 receptor influences nociceptive behaviors in a sex-specific manner. Its absence leads to increased analgesic behavior in female knockout mice. PMID: 27716994
  3. The D3 dopamine receptor, a member of the Gi-coupled D2 family of dopamine receptors, is expressed throughout limbic circuits, including the prefrontal cortex (PFC). PMID: 28522735
  4. This study demonstrates that DRD3 signaling induces the expression of suppressor of cytokine signaling 5, a negative regulator of Th2 development, indirectly favoring the acquisition of Th1 phenotype. PMID: 27183640
  5. This study shows that D3R regulates the impact of methamphetamine on LPS-induced mast cells activation. PMID: 27156126
  6. This study reveals that Genetic blockade of the dopamine D3 receptor enhances hippocampal expression of PACAP and its receptors, altering their cortical distribution. PMID: 26718601
  7. Results suggest that the dopamine D3 receptor is centrally involved in the development of adult anxiety- and depression-related behaviors stemming from repeated stressful experiences during childhood. PMID: 26619275
  8. D3R modulates the function of GABAA receptors in the striatum. Chronic blockade of D3R increases alpha6 subunit expression, inducing insensitivity to the anxiolytic effect of diazepam. PMID: 25482686
  9. This study identified a unique role for Npas2 in regulating cocaine reward and dopamine Drd3 receptor expression. PMID: 25444159
  10. Results suggest that D3 receptors and their signaling mechanisms play key roles in the reconsolidation of cocaine memories in mice, indicating their potential as novel targets for treating cocaine abuse in humans. PMID: 25149631
  11. D5 receptors regulate CD4(+)T-cell activation and differentiation by modulating ERK activation and cAMP production. PMID: 26025054
  12. Overexpression of D3Rs in the striatum of mice does not induce cognitive deficits but disrupts motivation, suggesting that alterations in D3Rs may contribute to the negative symptoms of schizophrenia. PMID: 24387821
  13. This study showed that low-dose pramipexole causes a D3 receptor-independent reduction in locomotion and responding for a conditioned reinforce. PMID: 25283483
  14. D3R deficiency results in anxiety-like and depressive-like symptoms not attributable to motor dysfunction. PMID: 25110304
  15. This study demonstrated that the dopamine D3 receptor is essential for ethanol consumption in mice. PMID: 24584330
  16. Our findings suggest that the D3 receptor modulates the mu opioid receptor system in the spinal cord, and dysfunction of the D3 receptor can induce a morphine-resistant state. PMID: 24966815
  17. Data supports the notion that D3Rs might modulate CREB phosphorylation after acquisition of PA, likely via activation of ERK signaling. PMID: 24100927
  18. The dopamine D3 receptor plays a critical role in the development of aging-related cardiac fibrosis, remodeling, and dysfunction. PMID: 24023697
  19. Our finding reveals that mice lacking D3Rs show enhanced tissue plasminogen activator proteolytic activity on BDNF. PMID: 23906635
  20. The findings of this study suggest that D3Rs play an important role in mediating cocaine's rewarding effects. PMID: 23643749
  21. These results suggest that D3 receptors play a key role in reconsolidation of cocaine-induced conditioned place preference in mice. PMID: 23506736
  22. This study demonstrated that D3 receptor-deficient mice displayed attenuated MPTP-induced locomotor activity changes. Consistent with the behavioral observations. PMID: 23902361
  23. Dopamine D3 receptor activation increases neural stem cell numbers in adult subventricular zone neurospheres from wild-type but not D3R knock-out mice. . PMID: 23322492
  24. In female mice, knockout of the dopamine D3 receptor had no effect on spatial working memory (SWM) in the Sham groups, but had a positive effect on SWM in the OVX groups. PMID: 23511253
  25. The renal D5R protein upregulation was not due to increased transcription because renal mRNA expression of D5R was similar in D3(-/-) and D3(+/+) mice. PMID: 23753418
  26. The binding of the REV-ERBalpha protein to the DRD3 promoter increased in the early dark phase. PMID: 23429911
  27. Mice lacking the D3 receptor might be more resistant to stressful procedures. PMID: 23357086
  28. The glutamate-D(3) receptor interactions described here offer a conceptual framework for developing new D(3) receptor-selective drugs, potentially providing a novel, effective, and safe approach to indirectly target glutamate in schizophrenia. PMID: 23001156
  29. These findings indicate that D3R expressed on CD4(+) T cells plays a crucial role in the physiopathology of MPTP-induced Parkinson's disease in a mouse model. PMID: 23589621
  30. Stimulation of D3R transiently activates the Akt/GSK-3beta pathway in the two populations of medium-size spiny neurons of the nucleus accumbens and dorsal striatum. PMID: 23410496
  31. D3 receptor activation results in changes in intracellular [Ca(2+)] dynamics, leading to reduced insulin secretion. PMID: 22918877
  32. The present data do not support a necessary role for the D3 receptor in the direct reinforcing effects of cocaine. PMID: 22867038
  33. The results of this study suggest a role for the DA D3 receptor in pain modulation and identify the D3KO as a potential model for increased nociception. PMID: 22995602
  34. These observations suggest that D3 receptors exert a tonic, constitutive inhibitory influence on adult hippocampal neurogenesis. PMID: 22957735
  35. Findings suggest that D(3)R deletion increases vulnerability to cocaine, and reduced D(3)R availability in the brain may constitute a risk factor for developing cocaine addiction. PMID: 23045656
  36. Dopamine D3 receptor knock-out mice developed lower morphine-induced tolerance and showed attenuated withdrawal signs compared to wild-type mice. PMID: 22154407
  37. These results suggest that D3 receptors modulate locomotor responses to both acute and repeated METH treatment. PMID: 22420045
  38. The present study identified the DR subtype as the most important receptor of the dopaminergic system to modulate intraocular pressure, having relevant implications for glaucoma, which represents one of the most debilitating optic neuropathies. PMID: 22178719
  39. This study demonstrated a synergistic effect of DRD3 polymorphisms on schizophrenia susceptibility. PMID: 21737144
  40. A single bilateral intrastriatal BDNF infusion is sufficient to rescue the reduced expression of dopamine receptor D3R. PMID: 20938680
  41. This study demonstrated the role of D3R as a regulator of dopaminergic effects in learning and attention processes. PMID: 21354213
  42. Results show a correlation among the dopamine D3 receptor, neurofibromin 1, and amyloid precursor protein in mouse brains, demonstrating the regional-specific regulation of NF1 in brains of D(3)R KO. PMID: 21170735
  43. Dopamine D1 but not D3 receptor is crucial for spatial learning. PMID: 20600656
  44. The results of this study confirmed the ability of iron deficiency and D3R-/- to evoke sensory and motor symptoms in mice resembling those observed in RLS patients. PMID: 21209191
  45. D(3) receptor-regulated cAMP-response element binding protein signaling in the hippocampus may be involved in these age-associated alterations. PMID: 20600590
  46. Dopaminergic stimulation of D3R drives proliferation via rapidly amplifying progenitor cells to promote murine subventricular zone neurogenesis. PMID: 20477937
  47. D3R(-/-) mice exhibited better basal cognitive performance compared to WT mice (p < 0.001). PMID: 20149873
  48. Amphetamine can induce significant conditioned place preference in dopamine D3 receptor knock-out mice. PMID: 18402112
  49. Mice lacking dopamine D3 receptors exhibit spatial working memory deficits. PMID: 12097513
  50. D3 activation of GIRK currents in substantia nigra neurons does not occur or is extremely rare. PMID: 12843272

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the D3 dopamine receptor and what distinguishes it from other dopamine receptor subtypes?

The D3 dopamine receptor is a G protein-coupled receptor that primarily functions by inhibiting adenylyl cyclase activity. It plays a distinctive inhibitory role in the regulation of rodent locomotor activity, often opposing the behavioral and intracellular signaling effects mediated by concurrent D1 and D2 receptor stimulation . The D3 receptor exhibits a more localized expression pattern compared to other dopamine receptors and frequently co-expresses with other dopamine receptor subtypes, particularly D1 and D2 receptors, with regional, sex, and age-dependent differences in this co-expression pattern .

Unlike other dopamine receptors, D3 receptors couple robustly to adenylate cyclase V (ACV) and G protein-coupled inward rectifier potassium (GIRK) channels in heterologous cell lines, though the in vivo coupling mechanisms are still being characterized . Functionally, D3 receptor promotes cell proliferation and has been implicated in numerous neurobiological processes .

What mouse models are available for studying D3 dopamine receptor expression and function?

Several mouse models have been developed for D3 receptor research, with the following being most commonly utilized:

  • drd3-EGFP transgenic mice: These transgenic mice express enhanced green fluorescent protein (EGFP) in cells that natively express D3 receptor mRNA. Importantly, these mice do not express a D3 receptor-EGFP fusion protein; rather, the EGFP reporter gene is under the control of the D3 receptor gene promoter. This allows for identification and characterization of cells that naturally express D3 receptors without altering receptor function .

  • Strain-specific models: C57BL/6J and DBA/2J inbred mouse strains show differential D3 receptor expression and function, making them valuable comparative models. C57BL/6J mice exhibit reduced D3 receptor-mediated inhibitory function relative to DBA/2J mice, which correlates with behavioral differences in response to novelty, amphetamine, and D1 receptor stimulation .

  • D3 receptor knockout mice: These models have been instrumental in demonstrating the inhibitory role of D3 receptors in locomotor activity and have supported findings from pharmacological and antisense knockdown studies .

How is D3 receptor expression visualized and quantified in mouse brain tissue?

D3 receptor expression can be visualized and quantified through several complementary techniques:

  • Transgenic reporter systems: The drd3-EGFP transgenic mice allow for direct visualization of cells expressing D3 receptor mRNA through fluorescence microscopy. This approach enables identification of D3 receptor-expressing cells for further characterization .

  • Immunocytochemistry: Antibody-based detection using specific anti-D3 receptor antibodies such as the rabbit polyclonal antibody ab42114, which can be applied for immunocytochemistry/immunofluorescence (ICC/IF) with appropriate cell fixation (4% formaldehyde) and blocking protocols (1%BSA/10% normal goat serum/0.3M glycine in 0.1% PBS-Tween) .

  • In situ hybridization: This technique detects D3 receptor mRNA in tissue sections and has been used to validate the expression pattern in drd3-EGFP transgenic mice .

  • Western blotting: For protein-level quantification, Western blotting using specific antibodies can detect D3 receptor protein at approximately 50 kDa (though the predicted band size is 44 kDa) .

  • Quantitative RT-PCR: This method enables precise quantification of D3 receptor mRNA expression levels and can be performed on whole tissues or isolated single cells .

What is the expression pattern of D3 dopamine receptor in different brain regions?

The D3 dopamine receptor exhibits a highly localized expression pattern in the brain with significant regional specificity. Key findings include:

  • Cell-type specificity: D3 receptor is expressed in neurons, with region-specific expression in both glutamatergic and GABAergic populations. This suggests diverse roles in excitatory and inhibitory neurotransmission depending on brain region .

  • Co-expression patterns: The D3 receptor is frequently co-expressed with other dopamine receptor subtypes, primarily D1 and D2 receptors. This co-expression shows regional, sex, and age-dependent patterns, indicating complex regulation and potentially diverse functional outcomes .

  • Strain differences: Expression levels vary between mouse strains, with documented differences between C57BL/6J and DBA/2J mice, which may account for behavioral and pharmacological response differences between these strains .

  • Functional correlates: The expression patterns correlate with the inhibitory role of D3 receptors in locomotor activity, suggesting concentration of these receptors in circuits involved in motor control and reward processing .

How do regional, sex, and age-dependent differences influence D3 receptor expression and function?

Research has identified multiple biological factors that modulate D3 receptor expression and function:

  • Regional differences: D3 receptor expression varies significantly across brain regions, with higher expression in limbic structures and specific subregions of the striatum. This regional specificity contributes to its selective role in reward processing, emotional regulation, and specific motor functions .

  • Sex differences: Sex-dependent differences in D3 receptor co-expression patterns with other dopamine receptors have been documented, suggesting potential mechanisms for sex-based differences in dopaminergic responses and vulnerability to neuropsychiatric disorders. These differences may underlie sex-based variations in cognitive and affective symptoms in conditions like Parkinson's disease .

  • Age-dependent variations: D3 receptor expression and co-expression patterns change with age, which may contribute to age-related changes in dopamine signaling. These alterations could partially explain age-dependent vulnerability to dopamine-related disorders and differential responses to dopaminergic medications across the lifespan .

  • Strain differences: Genetic background significantly influences D3 receptor expression and function, as evidenced by differences between C57BL/6J and DBA/2J mice. These strain differences provide valuable models for studying how genetic factors modulate D3 receptor-mediated effects .

What is known about the interaction between D3 receptor and other dopamine receptor subtypes?

  • Co-expression patterns: Single-cell RT-PCR studies have demonstrated that D3 receptors frequently co-express with D1 and D2 receptors in the same neurons, with regional variations in this co-expression pattern .

  • Functional opposition: The D3 receptor exerts inhibitory opposition to D1 receptor-mediated signaling. This antagonistic relationship has been demonstrated in behavioral studies where D3 receptor activation counteracts D1-mediated locomotor stimulation .

  • Signal integration: In neurons co-expressing multiple dopamine receptor subtypes, the net effect on downstream signaling depends on the relative expression levels and activation states of each receptor type. This integration occurs at the level of second messenger systems, particularly adenylyl cyclase modulation .

  • Heterodimerization: Although not directly addressed in the provided search results, research has shown that D3 receptors can form heterodimers with other dopamine receptors, particularly D1 and D2, creating receptor complexes with unique pharmacological and signaling properties.

How do genetic variations in the D3 receptor gene influence cognitive and affective functions?

Genetic variations in the D3 receptor gene have significant implications for cognitive and affective functions:

  • rs6280 polymorphism: Research in Parkinson's disease patients has identified the rs6280 polymorphism as a significant modifier of cognitive and affective symptoms. The table below summarizes key findings regarding this polymorphism :

GenotypeCognitive/Affective PhenotypeStatistical Significance
CC genotypeHigher impairment in initiation/perseverationp = 0.016
CC genotypeHigher impairment in construction abilitiesp = 0.004
TT genotypeHigher frequency of anxiety (HADS score ≥11)p = 0.028
CC genotypeHigher frequency of anxiety (HADS score ≥11)p = 0.028
TC genotypeLower frequency of anxiety (HADS score ≥11)p = 0.028
  • Genotype distribution: In a study of Parkinson's disease patients (n=253), the frequency of rs6280 genotypes was 46.2% (TT), 38.3% (TC), and 15.4% (CC), with an allelic frequency of C at 34.6%. This distribution was not significantly different from healthy controls .

  • Cognitive domain specificity: The rs6280 CC genotype appears to predispose individuals to specific cognitive deficits, particularly in executive function (initiation/perseveration) and visuoconstructional abilities, rather than causing global cognitive decline .

What signaling pathways are associated with D3 receptor activation and how can they be studied?

D3 receptor activation initiates several signaling cascades that can be studied through various approaches:

  • G protein coupling: The D3 receptor couples primarily to inhibitory G proteins (Gi/Go) that inhibit adenylyl cyclase, reducing cAMP production. This can be measured using cAMP assays in cells expressing recombinant D3 receptors or in native tissues .

  • GIRK channel modulation: D3 receptors couple robustly to G protein-coupled inward rectifier potassium (GIRK) channels. This coupling can be studied using electrophysiological techniques to measure potassium currents in response to D3 receptor activation .

  • Cell proliferation pathways: D3 receptor activation promotes cell proliferation, suggesting coupling to mitogenic signaling pathways. These effects can be assessed using proliferation assays and by measuring activation of downstream signaling molecules like ERK1/2 .

  • Co-expression with effector molecules: Single-cell RT-PCR can determine if D3 receptor-expressing cells co-express adenylate cyclase V (ACV) and different GIRK channel isoforms, providing insight into the molecular components of D3 receptor signaling in specific cell populations .

  • Functional antagonism: The D3 receptor's inhibitory opposition to D1 receptor signaling can be studied using behavioral assays that measure locomotor activity in response to D1 agonists with or without concurrent D3 receptor modulation .

What techniques are most effective for single-cell characterization of D3 receptor-expressing neurons?

Single-cell characterization of D3 receptor-expressing neurons requires specialized techniques to identify and analyze individual cells:

  • Fluorescent reporter mice: The drd3-EGFP transgenic mice developed by the Gene Expression Nervous System Atlas (GENSAT) project enable direct visualization of D3 receptor-expressing cells through EGFP fluorescence. This allows for targeted isolation of these cells for further analysis .

  • Single-cell RT-PCR protocol: Once isolated, individual fluorescent cells can be analyzed using single-cell RT-PCR to determine their neurochemical identity and expression profile. This technique can determine:

    • Whether D3 receptor-expressing cells are neurons or glia

    • If they are glutamatergic, GABAergic, or catecholaminergic

    • Whether they co-express other dopamine receptor subtypes (D1-D5)

    • If they express adenylate cyclase V (ACV) and GIRK channel isoforms

  • Primer design for single-cell RT-PCR: Effective primers and fluorogenic probes should be designed using specialized software (e.g., Primer Express) based on mouse mRNA sequences. Primers should span exon-exon junctions to minimize genomic DNA contamination. Examples include:

    • GAPDH primers: 5′-TGTGTCCGTCGTGGATCTGA-3′ and 5′-CCTGCTTCACCACCTTCTTGA-3′

    • D3 primers: 5′-GAACTCCTTAAGCCCCACCAT-3′ and 5′-GAAGGCCCCGAGCACAAT-3′

  • Standardization approach: A standard curve should be constructed for each brain region by combining total RNA and preparing serial dilutions of known concentrations. This enables accurate quantification of expression levels across samples .

How can researchers optimize antibody-based detection of D3 receptors?

Effective antibody-based detection of D3 receptors requires careful optimization of protocols:

  • Antibody selection: Use validated antibodies with demonstrated specificity for D3 receptor, such as the rabbit polyclonal antibody ab42114, which has been successfully used for multiple applications including Western blot, immunoprecipitation, ELISA, and immunocytochemistry/immunofluorescence .

  • Western blot optimization:

    • Recommended dilution: 1/750

    • Expected band size: The predicted band size is 44 kDa, but the observed band is typically around 50 kDa, likely due to post-translational modifications

    • Positive control: Use validated D3 receptor positive control (rat)

  • Immunocytochemistry/Immunofluorescence protocol:

    • Cell fixation: 4% formaldehyde for 10 minutes

    • Blocking: 1% BSA/10% normal goat serum/0.3M glycine in 0.1% PBS-Tween for 1 hour

    • This protocol helps permeabilize cells and block non-specific protein-protein interactions

    • Secondary antibody selection should match the host species of the primary antibody

  • Cross-reactivity considerations: Due to homology between dopamine receptor subtypes, validation of antibody specificity is crucial. Negative controls (such as D3 receptor knockout tissue) and positive controls should be included in experimental designs .

What approaches are recommended for comparing D3 receptor expression between different mouse strains?

When comparing D3 receptor expression between mouse strains (e.g., C57BL/6J vs. DBA/2J), several complementary approaches are recommended:

  • Quantitative RT-PCR: This technique provides precise quantification of D3 receptor mRNA expression. For strain comparisons:

    • Use a two-step methodology with standardized RNA extraction procedures

    • Construct standard curves from combined RNA samples of both strains

    • Include housekeeping genes (e.g., GAPDH) as internal controls

    • Analyze results using comparative quantification methods (ΔΔCt)

  • Receptor binding assays: These assays quantify receptor protein levels and binding characteristics:

    • Use radioligand binding with D3-selective ligands

    • Determine both regional binding density and binding affinity (Kd)

    • Compare results across multiple brain regions to identify region-specific differences

  • Functional assays: Measure D3 receptor-mediated effects through:

    • Locomotor activity testing with D3-selective agonists

    • Assessment of D3 receptor-mediated inhibition of D1-stimulated behaviors

    • Analysis of intracellular signaling responses to D3 receptor activation

  • Controls and standardization: For valid strain comparisons:

    • Maintain consistent age and sex across groups

    • Control for housing and handling conditions

    • Process and analyze samples from different strains in parallel

    • Include internal standards to account for inter-assay variability

What are the best practices for designing genetic studies of D3 receptor polymorphisms?

When designing genetic studies of D3 receptor polymorphisms, such as the rs6280 variant, researchers should consider:

  • Cohort selection and characterization:

    • Clearly define inclusion/exclusion criteria

    • Collect comprehensive demographic and clinical data

    • Match cases and controls for relevant variables (age, sex, education)

    • For disease-specific studies (e.g., Parkinson's disease), record disease duration, medication usage, and symptom severity

  • Genotyping strategy:

    • Select appropriate single nucleotide polymorphisms (SNPs) based on previous literature and functional significance

    • Use validated genotyping methods with appropriate quality control

    • Include population-appropriate controls to establish normal genotype distributions

    • Consider analyzing both genotype frequencies and allelic frequencies

  • Phenotype assessment:

    • Use validated cognitive and behavioral assessment tools (e.g., Dementia Rating Scale-2, Hospital Anxiety and Depression Scale)

    • Assess multiple domains (attention, executive function, memory, etc.)

    • Consider both categorical outcomes (impaired vs. non-impaired) and continuous measures

    • Define clear criteria for impairment (e.g., performance < 1st percentile)

  • Statistical analysis:

    • Conduct appropriate corrections for multiple comparisons

    • Consider potential confounders (education, age, disease severity)

    • Use multivariate approaches when appropriate

    • Report comprehensive statistics including p-values, effect sizes, and confidence intervals

How does the D3 receptor contribute to Parkinson's disease pathophysiology and symptoms?

The D3 receptor plays a complex role in Parkinson's disease (PD) pathophysiology and symptomatology:

  • Genetic influences: While the D3 receptor gene variant rs6280 doesn't appear to influence PD susceptibility (similar genotype distributions in PD patients and healthy controls), it significantly impacts cognitive and affective symptoms in PD patients .

  • Cognitive impairment: The rs6280 CC genotype predisposes PD patients to specific cognitive deficits:

    • Higher impairment in initiation/perseveration (23.1% of CC carriers vs. 7.7% of TT carriers)

    • Greater visuoconstructional deficits (25.6% of CC carriers vs. 7.7% of TT carriers)

    • These effects are domain-specific rather than causing global cognitive decline

  • Anxiety symptoms: The relationship between D3 receptor genotype and anxiety in PD follows a complex pattern:

    • Both TT (23.5%) and CC (23.1%) genotypes show elevated anxiety rates

    • The heterozygous TC genotype shows significantly lower anxiety rates (9.8%)

    • This suggests a potential heterozygote advantage or more complex genetic interactions

  • Treatment implications: Understanding D3 receptor genetics may help personalize treatment approaches:

    • PD patients with the CC genotype might benefit from early cognitive interventions

    • Anxiety treatment strategies might be tailored based on D3 receptor genotype

    • D3-selective agents might have differential effects based on patient genotype

What experimental approaches are used to study D3 receptor function in animal models of neurological disorders?

Several experimental approaches are employed to study D3 receptor function in animal models of neurological disorders:

  • Genetic models: These include:

    • Transgenic reporter mice (drd3-EGFP) that facilitate identification and characterization of D3 receptor-expressing neurons

    • D3 receptor knockout mice that allow assessment of disease phenotypes in the absence of D3 receptor signaling

    • Mouse strains with naturally occurring differences in D3 receptor function (e.g., C57BL/6J vs. DBA/2J)

  • Behavioral assessments: These evaluate D3 receptor-mediated effects on:

    • Locomotor activity (spontaneous and drug-induced)

    • Motor coordination and sensorimotor functions

    • Cognitive performance (learning, memory, executive function)

    • Anxiety-like and depressive-like behaviors

    • Reward processing and motivated behaviors

  • Molecular and cellular approaches:

    • Single-cell RT-PCR to characterize D3 receptor-expressing neurons in disease models

    • Immunohistochemistry to assess changes in D3 receptor distribution

    • Electrophysiological recordings to measure D3 receptor-mediated effects on neuronal activity

    • Measurement of signaling pathway activation (e.g., cAMP, GIRK channels)

  • Pharmacological interventions:

    • Administration of D3-selective agonists and antagonists

    • Assessment of interactions between D3 agents and other dopaminergic medications

    • Evaluation of D3 receptor-mediated modulation of L-DOPA effects in parkinsonian models

How do age and sex interact with D3 receptor function in neurodegenerative conditions?

Age and sex are important biological variables that interact with D3 receptor function in neurodegenerative conditions:

What potential therapeutic strategies target the D3 receptor in neuropsychiatric conditions?

The D3 receptor represents a promising therapeutic target in various neuropsychiatric conditions:

  • D3-selective compounds: Development of compounds with high selectivity for D3 over D2 receptors allows targeting of D3-mediated functions while minimizing D2-related side effects. These include:

    • Selective D3 agonists for conditions where enhanced D3 signaling might be beneficial

    • Selective D3 antagonists for conditions characterized by excessive D3 activity

    • Partial agonists that can normalize D3 signaling regardless of baseline activity

  • Genotype-guided approaches: Based on findings regarding the rs6280 polymorphism:

    • CC genotype carriers might benefit from specific interventions targeting executive dysfunction and visuoconstructional deficits

    • Different anxiety management strategies might be optimal for TT, TC, and CC genotype carriers

    • Personalized medicine approaches could optimize treatment based on D3 receptor genetic profile

  • Targeting D3-D1 interactions: Given the antagonistic relationship between D3 and D1 receptors:

    • Combined modulation of both receptor types might yield synergistic effects

    • D3 antagonists might enhance beneficial effects of D1 stimulation while minimizing adverse effects

    • This approach could be particularly relevant in conditions like Parkinson's disease where dopamine replacement therapy affects multiple receptor subtypes

How can emerging single-cell technologies advance our understanding of D3 receptor neuronal networks?

Emerging single-cell technologies offer unprecedented opportunities to advance D3 receptor research:

  • Single-cell RNA sequencing (scRNA-seq): This technology can provide comprehensive transcriptomic profiles of individual D3 receptor-expressing neurons, revealing:

    • The full complement of genes co-expressed with D3 receptors

    • Novel cell subtypes defined by distinct gene expression patterns

    • Developmental trajectories of D3 receptor-expressing neurons

    • Disease-associated transcriptomic changes in specific neuronal populations

  • Spatial transcriptomics: These methods maintain spatial information while providing transcriptomic data, enabling:

    • Mapping of D3 receptor-expressing cells within intact brain circuits

    • Identification of spatial relationships between different neuronal populations

    • Correlation of D3 receptor expression with circuit-level organization

  • Functional single-cell approaches: Combining transgenic reporter systems like drd3-EGFP with functional analysis enables:

    • Patch-clamp electrophysiology of identified D3 receptor-expressing neurons

    • Calcium imaging of neural activity in D3-positive populations

    • Optogenetic or chemogenetic manipulation of specific D3 receptor-expressing circuits

  • Integrative multi-modal analysis: Combining single-cell transcriptomics with functional and spatial information provides:

    • Comprehensive characterization of D3 receptor-expressing neurons

    • Insights into how molecular profiles relate to functional properties

    • Better understanding of how D3 receptor circuits are embedded within larger brain networks

What are the challenges in developing highly selective D3 receptor compounds?

Despite significant interest in D3 receptor-selective compounds, several challenges remain:

  • Structural homology: The high structural similarity between D2 and D3 receptors, particularly in the orthosteric binding site, makes developing highly selective compounds challenging. Strategies to address this include:

    • Targeting allosteric sites that may have greater sequence divergence

    • Developing bitopic ligands that engage both orthosteric and allosteric sites

    • Exploiting subtle differences in receptor-ligand interactions

  • Functional selectivity: D3 receptor ligands can exhibit functional selectivity (biased signaling), activating some pathways while inhibiting others. This complexity requires:

    • Comprehensive pharmacological characterization beyond simple binding assays

    • Assessment of multiple signaling pathways (G protein, arrestin, etc.)

    • Understanding how functional selectivity influences in vivo effects

  • Species differences: Differences in D3 receptor pharmacology between rodents and humans necessitate:

    • Careful translation of preclinical findings to human applications

    • Development of humanized mouse models for D3 receptor

    • Parallel testing in multiple species when possible

  • Regional and cellular context: The signaling outcomes of D3 receptor activation depend on cellular context, including:

    • Co-expression with other dopamine receptors and interacting proteins

    • Expression of downstream effectors like ACV and GIRK channels

    • Region-specific differences in receptor coupling efficiency

How might advances in D3 receptor research impact precision medicine approaches for neuropsychiatric disorders?

Advances in D3 receptor research have significant potential to inform precision medicine approaches:

  • Genotype-based stratification: The impact of genetic variants like rs6280 on specific cognitive and affective symptoms suggests opportunities for:

    • Genetic testing to guide treatment selection in disorders like Parkinson's disease

    • Development of genotype-specific therapeutic strategies

    • Prevention or early intervention in genetically susceptible individuals

  • Biomarker development: Characterization of D3 receptor expression and function may yield valuable biomarkers for:

    • Disease risk and progression

    • Treatment response prediction

    • Patient stratification in clinical trials

    • Monitoring target engagement of D3-directed therapeutics

  • Targeted circuit interventions: Understanding the specific neural circuits involving D3 receptors enables:

    • Circuit-specific therapeutic approaches (pharmacological, neuromodulatory)

    • Personalized symptom management based on affected circuits

    • Novel intervention strategies like transcranial magnetic stimulation or deep brain stimulation targeted to D3-rich regions

  • Combinatorial treatment approaches: Knowledge of D3 receptor interactions with other systems informs:

    • Rational polypharmacy targeting multiple receptors

    • Synergistic treatment combinations

    • Mitigation of side effects through targeted receptor modulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.