Recombinant Mouse D (4) dopamine receptor (Drd4)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Neurotransmission

Recombinant Drd4 models reveal its role in modulating corticostriatal glutamatergic and dopaminergic signaling:

  • Inhibition of Glutamate Release: D₄.7R variants suppress methamphetamine-induced glutamate release in corticostriatal terminals, linked to ADHD pathophysiology .

  • Cross-Talk with NMDA Receptors: Drd4 activation downregulates NMDA receptor surface expression, reducing excitatory postsynaptic currents in pyramidal neurons .

Table 2: Functional Differences Between D₄.4R and D₄.7R Variants

ParameterD₄.4R (4 repeats)D₄.7R (7 repeats)Source
Glutamate Release InhibitionModerateEnhanced
NMDA Receptor DownregulationLess pronouncedSignificant
Methamphetamine ResponsePartial bluntingStrong blunting

Pharmacological Implications

Recombinant Drd4 is pivotal for developing subtype-selective drugs:

  • Antagonist Design: The crystal structure of Drd4 bound to L745870 identifies an extended binding pocket as a target for subtype-selective antagonists .

  • Therapeutic Targets: D₄ receptors are implicated in ADHD and restless legs syndrome (RLS), with D₄.7R variants serving as a vulnerability factor .

Key Findings:

  • Subtype Selectivity: Mutations in TM2 (e.g., S91F) abolish dopamine activation, highlighting critical residues for ligand binding .

  • Heteromerization: D₄R forms heteromers with α₂A adrenergic and D₂ dopamine receptors, modulating impulsivity traits .

Research Applications

Recombinant Drd4 is utilized in diverse experimental approaches:

  1. Biochemical Assays: Studying receptor-ligand interactions and G-protein coupling .

  2. Electrophysiology: Measuring D₄R-mediated inhibition of pyramidal neuron excitability .

  3. Optogenetic Studies: Mapping corticostriatal glutamate release dynamics in vivo .

Commercial Availability: Recombinant Drd4 proteins are produced in mammalian (HEK293) and bacterial (E. coli) systems for high-throughput screening .

Polymorphisms and Functional Diversity

The DRD4 gene’s tandem repeat polymorphisms (2–11 repeats) influence receptor function:

  • Allelic Frequencies: D₄.4R (60%), D₄.7R (20%), and D₄.2R (8%) dominate in human populations .

  • Pathophysiological Links: D₄.7R is strongly associated with ADHD and substance use disorders due to enhanced dopamine-mediated inhibition of glutamate release .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize its development during production.
Synonyms
Drd4; D(4 dopamine receptor; D(2C dopamine receptor; Dopamine D4 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGNSSATEDGGLLAGRGPESLGTGAGLGGAGAAALVGGVLLIGLVLAGNSLVCVSVASER TLQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVASPVVCGLNDVPGRDPAVC CLENRDYVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV SDPTQGPFFPDCPPPLPSLRTSPSDSSRPESELSQRPCSPGCLLADAALPQPPEPSSRRR RGAKITGRERKAMRVLPVVVGAFLVCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN SALNPIIYTIFNAEFRSVFRKTLRLRC
Uniprot No.

Target Background

Function
The dopamine receptor D4 is responsible for neuronal signaling within the mesolimbic system of the brain, a region crucial for regulating emotions and complex behaviors. While activated by dopamine, it also responds to epinephrine, norepinephrine, and a range of synthetic agonists and drugs. Agonist binding triggers signaling through G proteins that inhibit adenylyl cyclase. Furthermore, it modulates the circadian rhythm of contrast sensitivity by regulating the rhythmic expression of NPAS2 in the retinal ganglion cells.
Gene References Into Functions
  1. Data suggest that heightened D4 receptor-mediated dopaminergic control over corticostriatal transmission could be a contributing factor to ADHD and other neuropsychiatric disorders. PMID: 28097219
  2. Findings indicate that selective D4R activation effectively restores impaired LTP in aging. PMID: 28975698
  3. Excessive suppression of NMDAR function may underlie the role of hD4.7 in attention deficit hyperactivity disorder. PMID: 27475724
  4. The G-protein coupled receptor, DRD4, relies on ARR1 and ARR4 for desensitization and internalization. PMID: 26169958
  5. This study demonstrated that the dopamine D4 receptor gene plays a significant role in increased exploratory and anxiolytic behavior, particularly in males, and these behaviors were positively correlated with increased alcohol consumption. PMID: 25914336
  6. Contrast sensitivity is diminished in Drd4-/- mice. PMID: 24048828
  7. Dopaminergic modulation of early long-term potentiation in stratum oriens occurs through NMDA receptors containing NR2B subunits via D4Rs. PMID: 21955919
  8. Data indicate that stimulating the dopamine D receptor is crucial for maintaining the normal rhythmic production of adenylyl cyclase 1 from transcript to enzyme activity. PMID: 21676039
  9. This study revealed that the dopamine D4 receptor plays a significant role in attention. PMID: 21458500
  10. The results of this study suggest that the dopamine drd4 receptor appears to be important for specific exploration. PMID: 21412225
  11. Data suggest that dopamine D4 receptors modulate not only the prefrontal cortex but also the cerebellar vermis, potentially reflecting an indirect modulation as D4Rs are minimally expressed in this region. PMID: 20646063
  12. No connection between analyzed polymorphisms of genes: DRD2, DRD3, DRD4, DAT, COMT, and schizophrenia was established. PMID: 20672519
  13. This result suggests an effect of 5-HTTLPR on externalizing behavior in the presence of DRD4 7r but no effect in its absence. PMID: 19696961
  14. The absence of D4Rs increases avoidance behavior to unconditioned stimuli and does not impair behavioral reactions to Pavlovian fear-conditioning. PMID: 11860516
  15. Postsynaptic activation of dopamine D4 receptors reduces GABAergic currents in globus pallidus neurons. PMID: 14684868
  16. D4R signaling is essential for the expression of juvenile hyperactivity and impaired behavioral inhibition, features relevant to this attention deficit disorder-like mouse model. PMID: 14699433
  17. These findings suggest that D1, D4, and NMDA receptors may interact functionally, and that developmental absence of D4 receptors might trigger compensatory mechanisms that enhance D1 receptor expression. PMID: 14997010
  18. The D4 dopamine receptor is found to be expressed in the subcommissural organ (SCO), an ependymal brain gland located in the roof of the third ventricle. PMID: 15197646
  19. Absence of dopamine D4 receptor increases blood pressure, possibly due to increased angiotensin II type 1 receptor expression. PMID: 16380537
  20. Dopamine D4 receptor knockout mice exhibit neurochemical changes consistent with decreased dopamine release. PMID: 17449106
  21. KLHL12 specifically interacts with the D4 polymorphism, forming a Cul3-E3 ligase complex with substrate specificity toward the D4 receptor. PMID: 18303015
  22. The absence of D4R is not sufficient to induce psychopathologies associated with heightened impulsivity and novelty seeking. PMID: 18456309
  23. Data indicate that the DRD4 receptor is involved in modulating glutamate neurotransmission, primarily in the striatum. PMID: 18536704
  24. Drd4 activation is required for normal expression of adenylyl cyclase type 1 and for regulating its catalytic activity by light. PMID: 19166506
  25. The D(4) dopamine receptor differentially regulates Akt/nuclear factor-kappaB and extracellular signal-regulated kinase pathways in D(4)MN9D cells. PMID: 11562449

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in olfactory bulb, hypothalamus, olfactory tubercle, brainstem and striatum.

Q&A

What expression systems are most effective for recombinant mouse DRD4 production?

The most effective expression system for recombinant mouse DRD4 production involves the Bac-to-Bac Baculovirus Expression System using High 5 strain of Spodoptera frugiperda cells . This approach typically utilizes a modified pFastBac1 vector containing an expression cassette with a hemagglutinin (HA) signal sequence followed by a FLAG-tag at the N-terminus . For optimal expression, the vector design should include a PreScission Protease recognition site followed by EGFP and a His10-tag at the C-terminus to facilitate purification .

When working with DRD4, it's important to consider protein engineering approaches to improve expression and stability. Successful strategies include replacing the long, disordered intracellular loop 3 (ICL3) with a thermostable variant of apocytochrome b562 (BRIL) and introducing specific point mutations like F1213.41W, P2015.52I, P3176.38A, and C18145.51R . These modifications have been shown to increase the melting temperature of the protein variant by 13°C compared to the wild-type protein, with further stabilization (an additional 20°C increase) achieved through the addition of selective antagonists like L745870 .

How can mouse DRD4 be effectively genotyped for research purposes?

For effective genotyping of mouse DRD4, DNA extraction from mouse tail tissue followed by polymerase chain reaction (PCR) is the standard approach . Specific primers have been established for this purpose: forward primer 5'-ACTCGTCCGTCTGCTCCTTCTTC-3' and reverse primer 5'-GCAGGACTCTCATTGCCTTG-3' . The PCR protocol typically employs the FastStartTaq kit (Roche 4738357001) for reliable amplification .

This genotyping approach is particularly important when working with specialized mouse models such as humanized DRD4 variants, which express the D4 receptor with the long intracellular domain characteristic of human DRD4 polymorphic variants . These models allow researchers to examine the causal relationship between specific receptor variants and behavioral phenotypes, with wild-type mice (expressing DRD4 with a shorter third intracellular loop comparable to the human D4.2R) serving as controls .

What binding assays can be used to characterize recombinant mouse DRD4?

Several radioligand binding assays have been developed to characterize recombinant mouse DRD4. The most informative approach involves comparative binding studies using different radioligands with varying selectivity profiles. [3H]nemonapride and [3H]raclopride are commonly used in this context, as they have different affinities for D4 receptors .

The D4-specific component can be determined by subtracting the Bmax values obtained with [3H]raclopride (which has very low affinity for D4Rs) from those obtained with [3H]nemonapride in tissue samples . This approach reveals that approximately 20% of the total D2-type binding in mouse brain represents the D4-like component . Validation of this approach can be achieved through parallel studies in D4R knockout mice, where the D4-specific binding component should be significantly reduced (typically by about 75%) .

RadioligandBinding PropertyUse in DRD4 Characterization
[3H]nemonaprideBinds D2-like receptors including D4RMeasures total D2-like binding
[3H]racloprideVery low affinity for D4RUsed to distinguish D4R from other D2-type receptors

It's important to note that species differences exist in binding properties, and pooled homogenates (e.g., frontal cortex, caudate putamen, and hippocampus) may show different binding characteristics compared to specific brain regions .

How does the structure of mouse DRD4 compare to human DRD4, and what implications does this have for translational research?

The crystal structure of mouse DRD4 provides valuable insights into structure-function relationships relevant to translational research. The mouse DRD4 (66% identical to human DRD4 in the whole amino acid sequence and 89% identical in the transmembrane region) shows key structural features that inform our understanding of ligand binding and receptor function .

Structural features around TM2, such as F882.61 and a hydrogen bond between E922.65 and S3517.36, appear to limit further extension of the pocket . Functional studies using cpGFP-based dopamine-activation assays confirm the importance of these structural elements, as mutations like S912.64L and L1083.28F dramatically reduce the inhibitory effects of selective antagonists, and S912.64F mutation can abolish receptor response to dopamine entirely .

These structural insights have significant implications for translational research, particularly in drug discovery efforts targeting specific dopamine receptor subtypes.

What are the functional differences between wild-type mouse DRD4 and humanized DRD4 variants, particularly in relation to neuropsychiatric conditions?

Humanized mouse models expressing DRD4 with the long intracellular domain of human DRD4 polymorphic variants (particularly D4.7R associated with ADHD) exhibit significant functional differences compared to wild-type mice expressing the native mouse DRD4 (comparable to human D4.2R) .

The expanded intracellular domain of the humanized D4 receptor confers a gain of function, resulting in blunted methamphetamine-induced cortical activation and reduced optogenetic and methamphetamine-induced corticostriatal glutamate release . This indicates that the D4 receptor plays a key role in the modulation of corticostriatal glutamatergic neurotransmission, with the polymorphic variants affecting this function differently .

The functional differences between the receptor variants are mediated through their differential abilities to form receptor heteromers. The D4.4R and D4.7R variants confer different properties to adrenergic α2A receptor (α2AR)-D4R heteromers and dopamine D2 receptor (D2R)-D4R heteromers . These heteromers are preferentially localized in the perisomatic region of frontal cortical pyramidal neurons and their striatal terminals, respectively .

These functional differences have significant implications for understanding the neurobiological basis of conditions like ADHD and other impulse-control disorders. Enhanced D4 receptor-mediated dopaminergic control of corticostriatal transmission appears to constitute a vulnerability factor for these conditions .

How do circadian rhythms affect DRD4 expression and function in mouse models?

DRD4 expression exhibits significant circadian fluctuations in multiple brain regions, with implications for experimental design and data interpretation. Studies have demonstrated marked differences in DRD4 mRNA expression between light and dark phases in various brain structures, including the retina, amygdala, pineal gland, retinal pigment epithelium, and substantia nigra .

Specifically, DRD4 mRNA levels in the retina and pineal gland of rodents are significantly higher during the dark phase compared to the light phase . This circadian variation has methodological implications for research, as behavioral assessments need to account for these temporal differences. Experimental protocols should specify the timing of experiments relative to the light-dark cycle, with many studies conducting behavioral assessments between 4-7 hours post-transition into both the light and dark phases (ZT 4-ZT7 and ZT16-ZT19, respectively) .

For experiments conducted during the dark phase, specialized lighting conditions (e.g., red light provided by a 60-watt bulb) are necessary to facilitate visibility without disrupting the animals' dark-phase conditions . These methodological considerations are essential for obtaining reliable and reproducible results when studying DRD4 function in mouse models.

What protein engineering strategies can optimize mouse DRD4 for structural studies?

Several protein engineering strategies have proven effective for optimizing mouse DRD4 for structural studies, particularly X-ray crystallography. The most successful approach involves a combination of techniques:

The combined effect of these modifications can increase the melting temperature (Tm) of the protein variant by 13°C compared to the wild-type protein, with the presence of selective antagonists further increasing the Tm by 20°C . These stability enhancements are critical for successful crystallization and structure determination.

What functional assays can be used to validate recombinant mouse DRD4 activity?

Multiple functional assays can be employed to validate the activity of recombinant mouse DRD4:

  • Thermal stability assays: Measuring the melting temperature (Tm) of purified receptor proteins with and without ligands provides a quantitative measure of protein stability and ligand binding . Increases in Tm upon ligand addition confirm functional ligand binding.

  • cpGFP-based dopamine-activation assays: Utilizing circular permuted GFP (cpGFP)-fusion dopamine receptor variants as in vivo dopamine-binding reporters allows real-time monitoring of receptor activation . This approach can confirm that engineered receptor variants maintain significant ability to respond to both agonists and antagonists .

  • Mutational analysis combined with functional readouts: Introducing specific mutations in key residues of the ligand-binding pocket (e.g., S912.64L, S912.64F, and L1083.28F) followed by functional assays can validate the structure-function relationships and the importance of specific residues for ligand binding and receptor activation .

  • Optogenetic-microdialysis experiments: These advanced techniques allow measurement of neurotransmitter release in response to specific stimuli, providing functional readouts of receptor activity in more complex systems . For example, this approach has been used to demonstrate that humanized D4 receptors with expanded intracellular domains blunt methamphetamine-induced and optogenetically-induced corticostriatal glutamate release .

These complementary approaches provide robust validation of recombinant DRD4 activity across multiple levels, from purified proteins to cellular systems and intact neural circuits.

How can receptor heteromerization of DRD4 be studied in mouse models?

Studying DRD4 heteromerization in mouse models requires specialized approaches that can detect and characterize specific receptor-receptor interactions:

  • Immunohistochemical analysis: This approach can identify the co-localization of DRD4 with potential partner receptors, such as adrenergic α2A receptors (α2AR) or dopamine D2 receptors (D2R), in specific brain regions and neuronal compartments . High-resolution imaging techniques are essential for accurate localization studies.

  • Knock-in mouse models: Generating mice expressing specific DRD4 variants (such as those with humanized intracellular loops corresponding to human polymorphic variants) allows investigation of how these variants affect heteromer formation and function . Comparisons between wild-type and variant receptors can reveal differences in heteromerization properties.

  • Combined optogenetic and microdialysis techniques: These approaches can measure functional outcomes of receptor heteromerization, such as changes in neurotransmitter release in response to specific stimuli . Differential responses between wild-type and mutant receptors can provide insights into the functional consequences of heteromerization.

  • Receptor-specific pharmacological tools: Using ligands with different selectivity profiles for the individual receptors and their heteromers can reveal functional interactions . For example, examining how α2AR ligands affect DRD4-mediated responses (or vice versa) can provide evidence for functional heteromerization.

These approaches have revealed that DRD4 forms functional heteromers with α2AR and D2R, with different properties depending on the DRD4 variant involved . The α2AR-D4R heteromers are preferentially localized in the perisomatic region of frontal cortical pyramidal neurons, while D2R-D4R heteromers are found in striatal terminals . These heteromers play important roles in modulating neuronal activity and neurotransmitter release, with implications for understanding the neurobiological basis of conditions like ADHD and other impulse-control disorders .

How do findings from mouse DRD4 studies translate to human DRD4-related conditions?

Findings from mouse DRD4 studies have significant translational relevance for understanding human DRD4-related conditions, particularly neuropsychiatric disorders like ADHD and impulse control disorders . Several factors influence this translational value:

  • Structural homology: Mouse DRD4 shares significant structural homology with human DRD4 (66% identical in the whole amino acid sequence and 89% identical in the transmembrane region), enabling structure-based insights into human receptor function and pharmacology .

  • Humanized mouse models: Knock-in mice expressing DRD4 with the long intracellular domain of human polymorphic variants (particularly D4.7R associated with ADHD) provide valuable tools to examine the causal relationship between specific receptor variants and behavioral phenotypes . These models have revealed that the expanded intracellular domain of the humanized D4 receptor confers a gain of function that affects corticostriatal glutamatergic neurotransmission .

  • Receptor heteromerization: Mouse studies have revealed important roles for DRD4 heteromers with α2AR and D2R in modulating neuronal activity and neurotransmitter release . These findings have direct relevance for understanding the mechanistic basis of DRD4-related conditions and for developing targeted therapeutic approaches .

The translational value of these findings is supported by the consistent associations between human DRD4 polymorphisms (particularly D4.7R) and conditions like ADHD and substance use disorders . The mechanistic insights gained from mouse studies, particularly regarding enhanced D4 receptor-mediated dopaminergic control of corticostriatal transmission as a vulnerability factor, align with clinical observations in these conditions .

What pharmacological approaches target mouse DRD4 for potential therapeutic development?

Research on mouse DRD4 has revealed several pharmacological approaches that hold promise for therapeutic development:

  • Subtype-selective antagonists: Compounds like L745870, which selectively bind DRD4 over other dopamine receptor subtypes, have been instrumental in structural and functional studies . The detailed understanding of the binding pocket structure, including the extended pocket specific to DRD4s, provides a foundation for developing improved subtype-selective antagonists .

  • Targeting receptor heteromers: The recognition that DRD4 forms functional heteromers with α2AR and D2R opens new possibilities for developing heteromer-specific ligands . Since these heteromers play important roles in modulating neuronal activity and neurotransmitter release in circuits relevant to ADHD and impulse control disorders, heteromer-targeted approaches may offer improved therapeutic specificity .

  • Allosteric modulators: Structural insights into DRD4, particularly regarding the extended binding pocket and key structural features that limit its extension (such as F882.61 and the hydrogen bond between E922.65 and S3517.36), provide opportunities for developing allosteric modulators with unique functional properties .

These approaches are particularly relevant for conditions like ADHD, other impulse-control disorders, and restless legs syndrome, where DRD4 has been implicated as a therapeutic target . The ability to develop compounds that selectively target specific DRD4 variants or heteromers could potentially lead to more personalized therapeutic approaches based on individual genetic profiles.

What are the emerging technologies that could advance mouse DRD4 research?

Several emerging technologies hold promise for advancing mouse DRD4 research:

  • Cryo-electron microscopy (cryo-EM): While the current crystal structure of mouse DRD4 provides valuable insights, advancing to higher-resolution structures through cryo-EM could reveal additional details about receptor conformation, dynamics, and interactions with different ligands . This approach could be particularly valuable for studying DRD4 in complex with interaction partners or in different functional states.

  • Advanced optogenetic tools: Building on current optogenetic-microdialysis approaches, more sophisticated optogenetic tools could enable cell-type-specific and circuit-specific manipulation of DRD4-expressing neurons or DRD4-mediated signaling . This would allow more precise dissection of the functional roles of DRD4 in different neural circuits.

  • CRISPR/Cas9 genome editing: This technology enables more precise and efficient generation of mouse models with specific DRD4 variants or mutations . This could facilitate the creation of a wider range of humanized DRD4 variants to study the functional implications of different polymorphisms.

  • Single-cell transcriptomics and proteomics: These approaches could provide more detailed insights into the expression patterns of DRD4 and its interaction partners across different cell types and brain regions, as well as how these patterns change with circadian rhythms or in response to different stimuli .

  • Computational approaches: Advanced molecular dynamics simulations and machine learning approaches could enhance our understanding of DRD4 structure-function relationships and aid in the design of selective ligands targeting specific DRD4 variants or heteromers .

These technological advances could significantly enhance our understanding of DRD4 biology and accelerate the development of targeted therapeutic approaches for DRD4-related conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.