Recombinant Mouse DBH-like monooxygenase protein 1 (Moxd1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse DBH-like Monooxygenase Protein 1 (Moxd1)

Recombinant Mouse DBH-like monooxygenase protein 1 (Moxd1) is a member of the copper-dependent monooxygenase family . Moxd1 plays a significant role in various biological processes, including tumor development and neuronal functions . Studies have shown that Moxd1 expression levels can serve as a marker for sexual dimorphism in specific brain regions and influence tumor growth and metastasis in Glioblastoma (GBM) .

Gene Information

The MOXD1 gene encodes the monooxygenase DBH like 1 protein . It is expressed in various tissues and is involved in oxygenase-catalyzed reduction and activation of oxygen molecules, incorporating oxygen atoms into organic molecules .

Expression and Localization

Moxd1 mRNA expression is prominent in the following areas :

  • Brain: Highly expressed in the medial preoptic area (MPOA), specifically the sexually dimorphic nucleus (SDN-POA), bed nucleus of the stria terminalis, posterodorsal (BNSTpr), and medial amygdala, posterodorsal part (MePD) . It is also found in the cerebral cortex, dorsal tenia tecta, subplate layer, olfactory tubercle, striatum, nucleus accumbens, hippocampus, dentate gyrus, and cerebellar Purkinje cells .

  • Other Tissues: Also present in the colloid plexus and dura .

Role in Glioblastoma (GBM)

Research indicates that high MOXD1 expression is associated with poor survival rates in GBM patients . MOXD1 knockdown inhibits cell viability, proliferation, migration, invasion, and tumorigenesis of GBM cells . This suggests MOXD1's involvement in GBM development, offering a potential therapeutic target .

4.1. Impact on Cell Proliferation and Tumor Growth

MOXD1 knockdown reduces GBM cell proliferation and induces cell cycle arrest at the G2/M phase . It also reduces the expression of key proteins like CDK1, CDK2, Cyclin A1, and Cyclin B1, which are involved in cell cycle progression . Furthermore, MOXD1 knockdown inhibits self-renewal and tumor growth of GBM cells in vivo .

4.2. Effects on Cell Migration and Invasion

MOXD1 affects the migration and invasion capabilities of GBM cells . Knockdown of MOXD1 significantly delays the confluence rate of GBM cells and reduces cell invasion and migration . Additionally, MOXD1 knockdown downregulates N-cadherin, β-catenin, Vimentin, MMP2, and MMP9, while upregulating E-cadherin .

Role as a Tumor Suppressor in Neuroblastoma

MOXD1 acts as a lineage-restricted tumor-suppressor gene in neuroblastoma . Overexpression of MOXD1 in ADRN-like cells prolongs survival and reduces tumor burden in in vivo mouse models .

Sexual Dimorphism

Moxd1 serves as a marker for sexual dimorphism in the MPOA, BNSTpr, and MePD of mice . The number of Moxd1 mRNA-positive cells in these regions is greater in male mice than in female mice . Neonatal castration reduces the number of Moxd1 mRNA-positive cells in the SDN-POA of adult male mice, indicating that Moxd1 expression is influenced by hormonal environment during the perinatal period .

Tables Summarizing Key Findings

7.1. MOXD1 Expression and GBM Patient Survival

ParameterFinding
MOXD1 ExpressionHigher in GBM tissues compared to adjacent normal tissues
Survival RateHigh MOXD1 expression associated with poor survival
Cell ProliferationMOXD1 knockdown inhibits cell proliferation
Cell CycleMOXD1 knockdown induces G2/M phase cell cycle arrest
Cell Migration and InvasionMOXD1 knockdown reduces cell migration and invasion
Tumor Growth in Xenograft ModelSmaller tumor size in mice injected with MOXD1 knockdown GBM cells

7.2. MOXD1 Expression in Brain Regions and Sexual Dimorphism

Brain RegionMoxd1 ExpressionSexual Dimorphism
SDN-POAStrongHigher expression in males; reduced by neonatal castration
BNSTpr and MePDUniformHigher expression in males
Cerebral Cortex (CTX)Strong signals in dorsal tenia tecta (DTT) and subplate layerNo significant sexual dimorphism reported
Cerebellar Cortex (Purkinje cells)AbundantNo significant sexual dimorphism reported

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
Moxd1; Dbhr; Mox; DBH-like monooxygenase protein 1; DBH-related protein; Monooxygenase X
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-613
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Moxd1
Target Protein Sequence
SPGRSYPHRVVLDPEGKYWLHWGRQGERLAFRLEVRTNGYVGFGFSPTGSMAAADIVVGG VAHGRPYLQDYFTNADRELEKDAQQDYHLDYAMENSTHTVIEFSRELHTCDVNDKSLTDS TVRVIWAYHHDDPGESGPKYHDLNRGTRSLRLLNPEKANVVSTVLPYFDLVNQNVPIPNK GTTYWCQMFKIPTFQEKHHVIKVEPIIERGHENLVHHILVYQCSSNFNDSVLDFGHECYH PNMPDAFLTCETVILAWGIGGEGFTYPPHVGLSLGMPLDPRYVLLEVHYDNPARRKGLID SSGLRVFHTTDIRRYDAGVIEAGLWVSLFHTIPPGMPEFHSEGHCTLECLEEALGAEKPS GIHVFAVLLHAHLAGKGIRLRHFRKGEEMKLLAYDDDYDFNFQEFQYLREEQTILPGDNL ITECRYNTKDRAVMTWGGLSTRNEMCLSYLLYYPRVNLTRCSSIPDIMEQLQFIGVKEIY RPVTTWPFIIKSPKQYRNLSFMDAMNKFKWTKKEGLSFNKLVLSLPVNVRCSKTDNAEWS IQGMTAIPPDIKRPYEAEPLVCEKAASPPLHGIFSLRLLTCALLLGSMLSSQGL
Uniprot No.

Target Background

Gene References Into Functions
  1. Based on its sequence and predicted endoplasmic reticulum localization, MOX (monooxygenase X) is hypothesized to hydroxylate a hydrophobic substrate. [PMID: 15337741]
Database Links
Protein Families
Copper type II ascorbate-dependent monooxygenase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Tissue Specificity
Broadly exprressed, with highest levels in salivary gland and ovary.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.