Recombinant Mouse DDB1- and CUL4-associated factor 17 (Dcaf17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Dcaf17; DDB1- and CUL4-associated factor 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-519
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Dcaf17
Target Protein Sequence
MGRTRKANVCRRLSRRALGFYARDAGVVQRTNLGILRALVCQESTKFKNVWTTHSKSPIA YERGRIYFDNYRCCVSSVASEPRKLYEMPKCSKSEKIEDALLWECPVGDILPDPSDYKSS LIALTAHNWLLRISATTGEVLEKIYLASYCKFRYLSWDTPQEVIAVKSAQNKGSAAARQA GTSPPVLLYLAVFRVLPFSLVGILEINKKVFENVTDATLSHGILIVMYSSGLVRLYSFQA IIEQFMQQKLDLGCACSQGGTTGTVGEAPFGIPCNVKITDSPPPLFEVSSLENAFQIGGH PWHYIITPNKKKQKGVFHICALKDNSLAKNGIQEMECCSLESDWIYFHPDASGRIIHVGP NQVKVLKLSEVENDSSQHQISEDFVIWAKREDRKENLITVTASGRVVKRNVSLLDDDPEQ ETFKIVDYEDELDLLSVVAVTQIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVTYSHEVY FDRDLVLHIEQKPNRVFSCYVYQMVCDPGEEEEAVNRSG
Uniprot No.

Target Background

Function
May function as a substrate receptor for the CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Nucleus, nucleolus. Note=According to PubMed:19026396, it is a nucleolar protein, while sequence analysis programs clearly predict 2 transmembrane regions.
Tissue Specificity
Ubiquitously expressed in the embryo, with higher expression in brain, liver and skin tissues.

Q&A

What is Dcaf17 and what is its primary function in cellular processes?

Dcaf17 (DDB1- and CUL4-associated factor 17) is a member of the DCAF family genes that encode substrate receptor proteins for Cullin-RING E3 ubiquitin ligases. These complexes play critical roles in numerous cellular processes by mediating protein ubiquitination . Dcaf17 is predicted to be involved specifically in protein ubiquitination pathways and is considered a component of the Cul4-RING E3 ubiquitin ligase complex . The highest expression of Dcaf17 is observed in testicular tissue, suggesting a specialized role in reproductive biology .

What is known about the subcellular localization of Dcaf17?

Based on predictive analyses, Dcaf17 is localized primarily to the membrane and nucleolus . This dual localization pattern suggests that the protein may perform distinct functions depending on its subcellular context. The nucleolar localization is particularly interesting as it indicates potential involvement in ribosome biogenesis or other nucleolar functions, while membrane association suggests possible roles in signaling or protein trafficking.

How does Dcaf17 expression change during development?

Expression profiling of Dcaf17 during post-natal development of mouse testes demonstrates a gradual increase in Dcaf17 mRNA levels with age . This progressive upregulation correlates with the timeline of sexual maturation and spermatogenesis in mice, suggesting that Dcaf17 expression is developmentally regulated in a tissue-specific manner. The increasing expression pattern aligns with its critical role in spermiogenesis, which becomes fully active during sexual maturation.

What phenotypes are observed in Dcaf17 knockout mouse models?

Dcaf17 knockout mice exhibit several notable phenotypes, primarily affecting male reproductive function. These include:

PhenotypeDescriptionReference
Male infertilityComplete infertility in male mice
OligozoospermiaReduced sperm count
TeratozoospermiaAbnormal sperm morphology
AsthenozoospermiaSignificantly reduced sperm motility
GlobozoospermiaRound-headed sperm without acrosome
Normal female fertilityNo effect on female reproductive function

Importantly, female fertility remains unaffected in Dcaf17 knockout mice, indicating a sex-specific role for this gene in reproduction .

How can recombinant Dcaf17 protein be used in experimental research?

Recombinant Mouse DCAF17 protein, available as pre-coupled magnetic beads, offers several research applications:

  • Immunoassays for detecting Dcaf17 interactions with target proteins

  • Immunoprecipitation/Co-precipitation studies to identify binding partners

  • Protein separation and purification experiments

  • Cell sorting applications

These pre-coupled magnetic beads provide uniform particle size with narrow distribution and large surface area, facilitating convenient and fast capture of target molecules with high specificity . The beads can be integrated with automation equipment for high-throughput operations, making them suitable for large-scale protein interaction studies.

What methods are most effective for studying Dcaf17 function in vivo?

Based on published research methodologies, the most effective approaches for studying Dcaf17 function include:

  • Gene targeting to generate Dcaf17 knockout mice

  • Quantitative RT-PCR for expression profiling across tissues and developmental stages

  • Histological examination of affected tissues, particularly testis

  • Sperm morphology and motility analyses

  • Immunohistochemistry to detect subcellular localization

  • Protein interaction studies using recombinant Dcaf17 proteins

The combination of these approaches has proven effective in elucidating the critical role of Dcaf17 in spermatogenesis .

How does Dcaf17 contribute to spermiogenesis at the molecular level?

Dcaf17 plays a crucial role in several aspects of spermiogenesis. Disruption of Dcaf17 causes:

  • Asymmetric acrosome capping - affecting the formation of the specialized secretory vesicle needed for fertilization

  • Impaired nuclear compaction - essential for proper sperm head formation

  • Abnormal round spermatid to elongated spermatid transition - a critical step in sperm development

These defects suggest that Dcaf17, through its role in the ubiquitin-proteasome system, regulates protein turnover during critical stages of sperm development. The specific molecular targets of Dcaf17-mediated ubiquitination during spermiogenesis remain to be fully characterized, but likely include structural proteins involved in acrosome formation and nuclear reshaping .

What specific cellular abnormalities are observed in Dcaf17-deficient spermatogenesis?

Histological examination of Dcaf17-/- testes reveals several specific cellular abnormalities:

  • Presence of vacuoles in seminiferous tubules

  • Sloughed cells in the tubular lumen

  • Abnormal manchette morphology and perinuclear ring structure

  • Elongated manchette

  • Detached acrosome

  • Abnormal sperm flagellum, midpiece, and head morphology

  • Increased male germ cell apoptosis

These observations indicate that Dcaf17 is essential for maintaining the structural integrity of developing sperm cells and proper organization of the seminiferous epithelium.

How is Dcaf17 integrated into the Cullin-RING E3 ubiquitin ligase complex?

As a DCAF family member, Dcaf17 functions as a substrate receptor for Cullin-RING E3 ubiquitin ligases . Within this complex, Dcaf17 is predicted to interact with DDB1 (Damage-specific DNA Binding protein 1) and Cullin 4, forming part of the CUL4-RING E3 ubiquitin ligase complex . This complex facilitates the ubiquitination of specific target proteins, marking them for degradation by the proteasome. The identification of Dcaf17's specific substrates during spermatogenesis represents an important area for future research.

What is the relationship between mouse Dcaf17 and human reproductive disorders?

Studies of Dcaf17 knockout mice provide valuable insights into potential mechanisms underlying certain forms of male infertility in humans. The specific phenotypes observed in these mice, including oligozoospermia, asthenozoospermia, and teratozoospermia, closely resemble conditions observed in human male infertility cases .

Furthermore, the human ortholog of Dcaf17 (DCAF17) is implicated in Woodhouse-Sakati syndrome, a rare autosomal recessive disorder characterized by hypogonadism, alopecia, diabetes mellitus, mental retardation, and extrapyramidal signs . This connection suggests evolutionary conservation of Dcaf17 function and highlights the potential translational significance of mouse Dcaf17 research for understanding human reproductive and developmental disorders.

How might insights from Dcaf17 research contribute to male infertility treatments?

Understanding the molecular mechanisms through which Dcaf17 regulates spermatogenesis could inform novel diagnostic and therapeutic approaches for certain forms of male infertility. Key contributions may include:

  • Identification of potential biomarkers for specific types of male infertility

  • Development of targeted therapies that modulate ubiquitination pathways in spermatogenesis

  • Improved diagnostic classification of male infertility cases

  • Potential genetic screening approaches for individuals with unexplained infertility

The specificity of Dcaf17's effect on male fertility, without impacting female reproductive function, makes it a particularly interesting target for male-specific fertility interventions .

What are the challenges in studying ubiquitination targets of Dcaf17?

Identifying the specific substrates targeted by Dcaf17 for ubiquitination presents several technical challenges:

  • Transient nature of ubiquitination events

  • Potential redundancy with other ubiquitin ligase complexes

  • Tissue-specific expression patterns limiting sample availability

  • Complexity of the ubiquitin code (mono- vs. poly-ubiquitination, different chain linkages)

  • Technical limitations in capturing intact ubiquitin-substrate complexes

Recent advances in proteomics approaches, including ubiquitin remnant profiling and proximity labeling techniques, offer promising strategies to overcome these challenges and identify Dcaf17 substrates during spermatogenesis.

How do Dcaf17 functions compare between different model organisms?

While most detailed functional studies of Dcaf17 have been conducted in mice, the gene is conserved across various species. In zebrafish, dcaf17 is also predicted to be involved in protein ubiquitination and to be part of the Cul4-RING E3 ubiquitin ligase complex . The human ortholog DCAF17 shares functional characteristics with its mouse counterpart but has additional clinical significance through its association with Woodhouse-Sakati syndrome .

Comparative studies across species could provide insights into both conserved and species-specific functions of Dcaf17, particularly in reproductive development and function. Such evolutionary perspectives may help distinguish fundamental roles of the protein from species-specific adaptations.

What methodological approaches can be used to study Dcaf17's role in protein-protein interactions?

Several methodological approaches are particularly suitable for investigating Dcaf17's protein interaction network:

  • Immunoprecipitation using recombinant Dcaf17 protein pre-coupled magnetic beads

  • Yeast two-hybrid screening to identify direct interacting partners

  • Proximity-dependent biotin identification (BioID) to capture transient interactions

  • Co-immunoprecipitation followed by mass spectrometry

  • CRISPR-Cas9 screening to identify genetic interactions

These complementary approaches can help construct a comprehensive interaction map for Dcaf17, potentially revealing both established and novel components of the ubiquitination pathway in spermatogenesis.

What are the most promising future directions for Dcaf17 research?

Several promising avenues for future Dcaf17 research include:

  • Comprehensive identification of Dcaf17 substrates during different stages of spermatogenesis

  • Structural studies of Dcaf17 to elucidate substrate recognition mechanisms

  • Investigation of potential non-testicular functions of Dcaf17

  • Development of conditional/inducible Dcaf17 knockout models to study temporal requirements

  • Exploration of potential genetic modifiers of the Dcaf17 knockout phenotype

  • Translational studies connecting mouse Dcaf17 findings to human male infertility

These directions would significantly advance our understanding of both the basic biology of Dcaf17 and its potential clinical applications.

How might emerging technologies enhance Dcaf17 research?

Emerging technologies that could substantially advance Dcaf17 research include:

  • Single-cell transcriptomics and proteomics to track cell-specific expression patterns

  • CRISPR-based epigenome editing to modulate Dcaf17 expression

  • Advanced imaging techniques to visualize Dcaf17 localization during spermatogenesis

  • Organoid models to study Dcaf17 function in a controlled environment

  • Computational approaches to predict Dcaf17 substrates based on structural features

Integration of these technologies with established research approaches would provide unprecedented insights into Dcaf17 function and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.