Recombinant Mouse Developmental Pluripotency-Associated Protein 5B/5C (Dppa5b) refers to engineered versions of the murine Dppa5 gene product, which is implicated in maintaining pluripotency and regulating stem cell function. While Dppa5 is well-documented in human and murine systems, specific references to "Dppa5b" (5B/5C variants) are absent in the provided literature. This may reflect either a naming discrepancy, a focus on broader Dppa5 isoforms, or limited characterization of these subtypes. Below, we synthesize findings on Dppa5 in mice, as no data on 5B/5C variants were identified.
ER Stress Regulation: Dppa5 suppresses endoplasmic reticulum (ER) stress and apoptosis in HSCs, enhancing reconstitution capacity post-transplantation .
Chemical Chaperones: Agents like 4-phenylbutyric acid (4-PBA) mimic Dppa5’s effects, reducing ER stress and improving HSC engraftment .
High Expression: Undifferentiated pluripotent stem cells (PSCs) .
Downregulation: Occurs during lineage commitment (ectoderm, mesoderm, endoderm) .
Polyclonal Antibodies:
Control Fragments: Human Dppa5 (aa 1–51) used for blocking assays (e.g., with PA5-139826 antibody) .
Dppa5 (Developmental pluripotency-associated 5), also known as ESG1, is an RNA binding protein highly expressed in undifferentiated pluripotent stem cells . Its primary functions include:
Maintenance of embryonic stem cell pluripotency
Regulation of hematopoietic stem cell (HSC) activity
Suppression of endoplasmic reticulum (ER) stress
Association with specific target mRNAs for post-transcriptional regulation
While Dppa5 is important for pluripotency maintenance, research indicates it is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells .
Recombinant mouse Dppa5 protein has the following characteristics:
| Property | Value |
|---|---|
| Molecular Weight | 13.8 kDa (predicted) |
| Amino Acid Length | Complete CDS with C-terminal tag |
| Protein Sequence | MMVTLVTRKDIPPWVKVPEDLKDPEVFQVQSLVLKYLFGPQGSRMSHIEQVSQAMFELKNLESPEELIEVFIYGSQNNKIRAKWMLQSMAERYHLRQQKGVLKLEESMKTLELGQCIE (plus tag sequence) |
| Expression Host | HEK293T cells |
| Tag Options | C-terminal MYC/DDK |
| Buffer Composition | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| UniProt ID | Q9CQS7 |
| Cytogenetics | 9 E1 |
| Synonyms | AA536857, ESG1, ECAT2 |
The recombinant protein typically includes a C-terminal tag to facilitate purification and detection in experimental settings .
For maximum stability and activity of recombinant Dppa5 protein:
Store at -80°C after receiving vials
Avoid repeated freeze-thaw cycles as they can compromise protein integrity
For testing in cell culture applications, filter before use (note that some protein loss may occur during filtration)
Reconstitute lyophilized protein at approximately 200 μg/mL in buffer with controlled pH (similar to protocols for other recombinant proteins)
When stored properly, the protein remains stable for approximately 12 months from date of receipt
Functional verification of recombinant Dppa5 can be accomplished through:
Protein-protein interaction assays: Co-immunoprecipitation experiments to confirm interaction with known binding partners, particularly NANOG
RNA binding assays: RNA immunoprecipitation followed by sequencing (RIP-seq) to identify bound RNA targets
Cellular assays:
Western blot analysis: Using tag-specific antibodies to confirm protein expression and integrity
Dppa5 has been identified as a critical regulator of ER stress in hematopoietic stem cells (HSCs). The mechanism involves:
Reduction of ER stress markers: Ectopic expression of Dppa5 suppresses ER stress markers in HSCs
Improved reconstitution capacity: HSCs with Dppa5 overexpression show robustly increased reconstitution levels after bone marrow transplantation through suppression of ER stress and apoptosis
Physiological necessity: Knockdown experiments demonstrate that Dppa5 depletion impairs long-term reconstitution ability of HSCs due to elevated ER stress levels, confirming the physiological importance of this pathway
Chemical chaperone effects: Notably, chemical chaperones that decrease ER stress in HSCs also increase HSC engraftment, suggesting a generalizable principle
This represents a pivotal connection between ER stress regulation and stem cell properties in HSCs, with significant implications for ex vivo HSC manipulation for clinical applications .
Dppa5 regulates NANOG through post-transcriptional mechanisms:
Direct physical interaction: Coimmunoprecipitation experiments demonstrate that Dppa5 directly interacts with NANOG protein
Protein stabilization: Dppa5 increases NANOG protein levels without affecting mRNA levels, suggesting a post-transcriptional mechanism
Enhanced NANOG function: The stabilization of NANOG by Dppa5 enhances the regulatory effects of NANOG on target genes, including SALL4, a transcription factor required for ESC pluripotency
Feeder-free culture relevance: Human PSCs cultured on feeder-free substrates (including Matrigel, Laminin-511, Vitronectin, or synthetic polymers) show significantly higher DPPA5 expression compared to cells grown on mouse embryonic fibroblasts, suggesting substrate-dependent regulation
The DPPA5-NANOG interaction represents an important regulatory mechanism for maintaining pluripotency in stem cells, particularly under feeder-free culture conditions that are increasingly important for clinical applications .
Researchers investigating Dppa5's role in reprogramming can employ these methods:
Overexpression experiments:
Introduce Dppa5 expression vectors into somatic cells along with standard reprogramming factors (e.g., OCT4, SOX2, KLF4, c-MYC)
Quantify reprogramming efficiency by counting colonies expressing pluripotency markers (e.g., alkaline phosphatase, SSEA-4, TRA-1-60)
Compare temporal dynamics of reprogramming with and without Dppa5 enhancement
Mechanistic studies:
RNA-binding partner identification:
Employ CLIP-seq (crosslinking immunoprecipitation followed by sequencing) to identify RNA targets of Dppa5 during reprogramming
Validate whether these interactions affect translation efficiency or mRNA stability of factors important for reprogramming
Knockdown/knockout experiments:
Identifying RNA targets of Dppa5 requires specialized techniques:
CLIP-seq approaches:
Perform UV crosslinking to stabilize RNA-protein interactions
Immunoprecipitate Dppa5 using tag-specific antibodies or Dppa5-specific antibodies
Sequence the bound RNA fragments to identify binding sites at nucleotide resolution
RIP-seq (RNA immunoprecipitation followed by sequencing):
Immunoprecipitate Dppa5 under native conditions
Extract and sequence associated RNAs
Compare to control immunoprecipitation to identify specific targets
Validation methods:
Identification of binding motifs:
Bioinformatic analysis of identified binding sites to derive consensus binding motifs
Validation of these motifs through mutational analysis
This approach can reveal how Dppa5 regulates specific mRNAs to maintain pluripotency and support reprogramming.
The study of Dppa5 paralogs remains an area requiring further research:
Limited paralog-specific data: While mouse Dppa5 (also known as Dppa5a) has been well-characterized, less information is available regarding the specific functions of Dppa5b and Dppa5c
Evolutionary considerations:
The Dppa5 gene family has undergone species-specific duplications
These paralogs likely arose through gene duplication events and may have evolved specialized functions
Comparative analysis across species can provide insights into conserved versus divergent functions
Experimental approaches for paralog differentiation:
Paralog-specific knockdown or knockout studies
Complementation experiments to test functional redundancy
Domain swapping to identify regions responsible for paralog-specific functions
Expression analysis:
Studies examining the expression patterns of different Dppa5 paralogs across developmental stages and tissues can reveal specialized roles
Single-cell RNA sequencing can identify cells expressing specific paralogs
Further research is needed to elucidate the potentially distinct roles of Dppa5 paralogs in pluripotency, differentiation, and reprogramming contexts.
Several experimental models provide valuable insights into Dppa5 function:
Mouse embryonic stem cells (mESCs):
Express high levels of endogenous Dppa5
Allow for genetic manipulation through CRISPR-Cas9 or siRNA approaches
Differentiation protocols can assess the impact of Dppa5 modulation on lineage commitment
Induced pluripotent stem cells (iPSCs):
Hematopoietic stem cells (HSCs):
Transgenic mouse models:
Conditional knockout models to study tissue-specific or developmental stage-specific requirements
Overexpression models to assess gain-of-function phenotypes
In vitro differentiation systems:
When utilizing recombinant Dppa5 protein in cell culture:
Protein delivery methods:
Direct addition to culture medium (limited by cellular uptake)
Protein transfection reagents (e.g., Chariot, ProDeliverIN)
Cell-penetrating peptide tags to facilitate uptake
Microinjection for single-cell applications
Concentration optimization:
Titration experiments to determine effective doses
Typical starting range: 100-500 ng/mL, based on protocols for similar recombinant factors
Cell viability assessments to identify potential toxic effects at high concentrations
Activity verification:
Positive controls such as known effects on NANOG stability or ER stress markers
Time-course experiments to determine optimal treatment duration
Combination with other factors to assess synergistic effects
Experimental controls:
Heat-inactivated protein controls
Tag-only protein controls when using tagged recombinant proteins
Vehicle controls matching the buffer composition
Pre-treatment considerations:
For effective Dppa5 loss-of-function studies:
siRNA/shRNA approaches:
Design multiple siRNA sequences targeting different regions of Dppa5 mRNA
For longer-term studies, use shRNA expressed from lentiviral vectors
Validate knockdown efficiency at both mRNA and protein levels
This approach has been successfully used in HSC studies to demonstrate the importance of Dppa5 in long-term reconstitution ability
CRISPR-Cas9 knockout strategies:
Design guide RNAs targeting early exons of Dppa5
Consider using paired guides for complete gene deletion
Screen for successful knockouts by DNA sequencing, Western blot, and functional assays
Create conditional knockouts (floxed alleles with inducible Cre) for temporal control
Validation approaches:
Consideration of redundancy:
In systems with multiple Dppa5 paralogs, consider simultaneous targeting to overcome potential functional redundancy
Use of degron tags for inducible protein degradation as an alternative approach
To study the Dppa5-NANOG interaction:
Co-immunoprecipitation (Co-IP):
Protein stability assays:
Protein domain mapping:
Generate truncated versions of both proteins to identify interaction domains
Use site-directed mutagenesis to identify critical residues for interaction
Employ peptide arrays to map minimal interaction sequences
Proximity labeling techniques:
BioID or TurboID fusions to Dppa5 to identify proximal proteins in living cells
APEX2 labeling for temporally controlled proximity labeling
Functional readouts:
Researchers may encounter these challenges:
Expression system selection:
Solubility issues:
Dppa5 may form inclusion bodies in bacterial expression systems
Optimization of induction conditions (temperature, inducer concentration, duration)
Use of solubility tags (e.g., MBP, SUMO) may improve soluble expression
Purification challenges:
Multiple purification steps may be needed to achieve >80% purity
Affinity chromatography using the C-terminal tag (e.g., DDK/FLAG tag) provides initial enrichment
Size exclusion chromatography to remove aggregates and truncated products
Ion exchange chromatography for final polishing
Activity preservation:
Quality control:
When facing contradictory results:
Context-dependent functions:
Expression level considerations:
Overexpression may yield different phenotypes than physiological expression
Knockdown efficiency may vary between studies
Quantify expression levels when comparing across studies
Redundancy mechanisms:
Other factors may compensate for Dppa5 loss in some contexts
Consider parallel pathways regulating similar processes
Investigate the expression of related family members that may compensate
Technical differences:
Antibody specificity issues may lead to discrepant results
Cell line authentication to ensure consistent genetic background
Passage number effects in cultured stem cells
Resolution strategies:
Perform side-by-side comparisons under identical conditions
Use multiple complementary approaches to validate findings
Collaboration with labs reporting different results to identify sources of variation
Accurate measurement of ER stress in HSCs requires:
Gene expression markers:
qRT-PCR for canonical ER stress genes: BiP/GRP78, CHOP, XBP1 (spliced vs. unspliced ratio)
RNA-seq for comprehensive analysis of the ER stress transcriptional response
Consider pathway analysis to distinguish between different branches of the unfolded protein response (UPR)
Protein-level markers:
Western blot for BiP/GRP78, phosphorylated eIF2α, ATF4, and CHOP
Immunofluorescence to assess subcellular localization of UPR sensors
Flow cytometry for intracellular staining of ER stress markers in rare HSC populations
Functional assays:
Single-cell approaches:
Single-cell RNA-seq to capture heterogeneity in the HSC response
ER stress reporter systems (e.g., XBP1 splicing reporters) compatible with flow cytometry
In vivo assessment:
Essential controls for RNA-binding experiments include:
Negative controls:
Non-specific RNA binding proteins (e.g., BSA) to establish background binding
RNA samples not expected to interact with Dppa5
Mutated versions of Dppa5 with disrupted RNA-binding domains
Binding specificity controls:
Competition assays with unlabeled RNA to demonstrate specific binding
Comparison of binding to random RNA sequences versus potential targets
RNase treatment controls to confirm RNA-dependence of observed interactions
Technical controls:
Input samples to normalize for RNA abundance differences
Mock immunoprecipitation controls using non-specific antibodies or pre-immune serum
Demonstration of consistent RNA integrity throughout the experiment
Validation approaches:
Secondary binding assays using different methodologies (e.g., EMSA following RIP)
In vivo crosslinking to capture physiologically relevant interactions
Functional studies to demonstrate the consequence of Dppa5-RNA binding
Computational analysis controls:
Use of appropriate statistical methods for peak calling in CLIP-seq data
Multiple biological replicates to ensure reproducibility
Comparison with published RNA-binding motifs or datasets
Understanding Dppa5 function may lead to several therapeutic applications:
Ex vivo HSC expansion:
Enhanced cellular reprogramming:
Cardiomyocyte development:
ER stress modulation:
Identification of Dppa5-regulated pathways may reveal new targets for treating diseases associated with ER stress
Applications in conditions where stem cell function is compromised by elevated ER stress
RNA-based therapeutics:
Understanding Dppa5's RNA-binding properties may inform the development of RNA-based therapeutic approaches
Targeting specific RNA species identified as Dppa5 partners
Advancing Dppa5 research would benefit from:
Structural biology approaches:
High-resolution crystal or cryo-EM structures of Dppa5 alone and in complex with RNA targets
NMR studies to understand the dynamics of Dppa5-RNA interactions
Computational modeling of RNA recognition by Dppa5
Advanced protein engineering:
Development of Dppa5 variants with enhanced stability or activity
Domain swap experiments to create chimeric proteins with novel properties
Optogenetic or chemically inducible Dppa5 variants for temporal control of activity
Single-molecule techniques:
FRET-based assays to study Dppa5-RNA binding dynamics in real-time
Single-molecule pull-down assays to characterize the stoichiometry of Dppa5 complexes
Super-resolution microscopy to visualize Dppa5 localization and dynamics in live cells
High-throughput screening approaches:
Development of reporter systems to identify compounds modulating Dppa5 activity
CRISPR screens to identify genetic modifiers of Dppa5 function
Proteomic approaches to comprehensively map the Dppa5 interactome
Integrative multi-omics:
Combined analysis of transcriptomics, proteomics, and functional genomics data
Single-cell multi-omics to understand Dppa5 function in heterogeneous stem cell populations