Recombinant Mouse Diacylglycerol O-acyltransferase 2 (Dgat2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted to suit your needs.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Dgat2; Diacylglycerol O-acyltransferase 2; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Dgat2
Target Protein Sequence
MKTLIAAYSGVLRGERRAEAARSENKNKGSALSREGSGRWGTGSSILSALQDIFSVTWLN RSKVEKQLQVISVLQWVLSFLVLGVACSVILMYTFCTDCWLIAVLYFTWLAFDWNTPKKG GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVNRDTIDYLLSKNGSGNAIIIVVGG AAESLSSMPGKNAVTLKNRKGFVKLALRHGADLVPTYSFGENEVYKQVIFEEGSWGRWVQ KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITVPKLEHPTQKDIDLYHA MYMEALVKLFDNHKTKFGLPETEVLEVN
Uniprot No.

Target Background

Function

Diacylglycerol O-acyltransferase 2 (DGAT2) is an essential acyltransferase catalyzing the final and committed step in triglyceride (TAG) synthesis. It utilizes diacylglycerol and fatty acyl-CoA as substrates, playing a crucial role in intracellular TAG synthesis and storage. DGAT2 is primarily responsible for incorporating endogenously synthesized fatty acids into triglycerides in the liver, contributing significantly to cytosolic lipid accumulation. Furthermore, DGAT2 functions as an acyl-CoA retinol acyltransferase (ARAT) and can utilize 1-monoalkylglycerol (1-MAkG) as an acyl acceptor for monoalkyl-monoacylglycerol (MAMAG) synthesis.

Gene References Into Functions
  1. DGAT1 and DGAT2 coordinately regulate dietary fat absorption, synthesizing TAG for distinct subcellular pools within enterocytes. PMID: 27836993, PMID: 28249764
  2. Excess intestinal DGAT2 reduces mRNA levels of fatty acid oxidation genes, suggesting a link between reduced oxidation and increased TAG secretion. PMID: 23643496
  3. Roles of MTP and DGAT2 in hepatic steatosis. PMID: 22355095
  4. DGAT2 catalyzes TAG synthesis and promotes storage in cytosolic lipid droplets, independent of ER localization. PMID: 21680734
  5. DAG-induced PKCε activation's role in NAFLD-associated hepatic insulin resistance. PMID: 21436037
  6. DGAT1 and DGAT2 are essential for most TAG synthesis in mice; DGAT function is necessary for lipid droplets in adipocytes, but not all cell types. PMID: 21317108
  7. DGAT2 upregulation's role in alcoholic fatty liver disease. PMID: 20739640
  8. Increased hepatic TAG secretion and accumulation in ob/ob mice correlate with increased DGAT1 and DGAT2 activities. PMID: 12032764
  9. DGAT2's role in assembling de novo synthesized fatty acids into VLDL particles in the liver. PMID: 12413942
  10. Increased DGAT2 expression in diabetic mice. PMID: 14521909
  11. DGAT2's fundamental role in mammalian triglyceride synthesis and its requirement for survival. PMID: 14668353
  12. Leptin's regulation of adipocyte size by altering DGAT expression via the central nervous system, influencing triglyceride synthesis. PMID: 15550388
  13. DGAT1's role (but not DGAT2's) in VLDL synthesis; increased plasma VLDL may promote obesity, while increased DGAT2 activity contributes to steatosis. PMID: 15797871
  14. Hepatic DGAT2 overexpression significantly increases liver triglyceride content. PMID: 16877777
  15. Diacylglycerol acyltransferase 2 expression is regulated by C/EBPβ and C/EBPα during adipogenesis. PMID: 17504763
  16. DGAT2 synthesizes the majority of triglycerides secreted by the liver. PMID: 18252207
  17. Increased expression of diacylglycerol acyltransferase-1 and -2, along with delta-5- and delta-6- fatty acid desaturases, in hepatic triglyceride synthesis. PMID: 18280001
  18. DGAT2, an ER-resident enzyme, is also found in mitochondria-associated membranes, with its N-terminus potentially mediating mitochondrial association. PMID: 19049983
Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lipid droplet. Cytoplasm, perinuclear region.
Tissue Specificity
Predominantly expressed in liver. Also expressed in testis.

Q&A

What is the molecular structure of mouse Dgat2?

Mouse Dgat2 is a 38.6 kDa multipass membrane protein consisting of 334 amino acids . The protein contains two transmembrane domains with both the N-terminal and C-terminal regions facing the cytosol . The first transmembrane domain (TMD1) is critical for endoplasmic reticulum (ER) targeting, while the second transmembrane domain (TMD2) appears to have distinct functions . The protein's full-length sequence includes regions that are highly conserved across species, with human DGAT2 sharing 95% amino acid sequence identity with mouse DGAT2 over amino acids 268-377 .

What are the primary catalytic functions of Dgat2?

Dgat2 catalyzes the final step in triglyceride biosynthesis by transferring an acyl group from acyl-CoA to diacylglycerol (DG) . This enzymatic reaction is critical for:

  • Formation of triglycerides for energy storage

  • Assembly of very low-density lipoprotein (VLDL) particles in hepatocytes

  • Resynthesis of triglycerides in enterocytes during dietary fat absorption

Unlike its homolog MOGAT2 (also known as DGAT2L5), which preferentially catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA, Dgat2's primary function is the final acylation step in the triglyceride synthesis pathway .

What expression systems yield functional recombinant mouse Dgat2?

Based on available research data, several expression systems have been successfully employed to produce recombinant mouse Dgat2:

  • Cell-free expression systems: These have been used to produce recombinant mouse Dgat2 with ≥85% purity as determined by SDS-PAGE . This approach may help overcome challenges associated with membrane protein expression.

  • E. coli-based systems: For human DGAT2, E. coli-derived recombinant forms (amino acids 268-377) have been successfully produced . Similar approaches can be adapted for mouse Dgat2.

  • Mammalian expression systems: HEK293T and COS-7 cells have been utilized for expression of Dgat2 in functional studies, particularly when investigating subcellular localization and protein-protein interactions .

What are the optimal storage conditions for maintaining Dgat2 stability?

For extended storage of recombinant mouse Dgat2, the following conditions are recommended:

  • Store at -20°C or preferably -80°C for long-term storage

  • Avoid repeated freeze-thaw cycles, as these can decrease enzymatic activity

  • For working solutions, store aliquots at 4°C for up to one week

  • Inclusion of glycerol (typically 10-20%) in storage buffers helps maintain protein stability during freeze-thaw cycles

How does the subcellular localization of Dgat2 impact its function?

Dgat2 demonstrates a complex pattern of subcellular localization that directly influences its biological functions:

  • Endoplasmic Reticulum (ER): The primary site of Dgat2 localization, where it participates in triglyceride synthesis within the ER membrane .

  • Mitochondria: Dgat2 co-localizes with mitochondria, suggesting a potential role in coupling lipid synthesis with energy metabolism .

  • Lipid Droplets: Upon oleate loading or increased triglyceride synthesis, Dgat2 translocates to the surface of lipid droplets, where it may facilitate their expansion .

Research has demonstrated that the dual localization of Dgat2 allows for compartmentalized triglyceride synthesis, which may be particularly important during metabolic adaptations such as fasting or high-fat feeding .

What molecular determinants control Dgat2 trafficking between subcellular compartments?

The trafficking of Dgat2 between different subcellular compartments is governed by specific structural elements:

  • ER targeting: The first transmembrane domain (TMD1) contains the ER targeting signal. Studies have shown that when fused to a fluorescent reporter, TMD1 alone is sufficient to target the fusion protein to the ER .

  • Mitochondrial association: A Dgat2 mutant lacking both transmembrane domains localizes primarily to mitochondria, suggesting that these domains normally prevent mitochondrial targeting .

  • Lipid droplet association: The C-terminus of Dgat2 is essential for interaction with lipid droplets. Truncation or deletion of regions within the C-terminus prevents Dgat2 from co-localizing with lipid droplets even when cells are stimulated with oleate .

Does Dgat2 function as a monomer or within a complex?

Dgat2 functions as part of a multimeric complex consisting of several Dgat2 subunits . This oligomerization appears to be functionally significant for the following reasons:

  • Native Dgat2 forms approximately 680 kDa complexes, suggesting homo-multimerization of the 38.6 kDa protein .

  • The multimeric structure may facilitate efficient channeling of lipid intermediates during triglyceride synthesis.

  • Complex formation may also play a role in regulating the subcellular distribution of Dgat2 between the ER, mitochondria, and lipid droplets .

Research techniques such as co-immunoprecipitation and chemical crosslinking have been instrumental in demonstrating the multimeric nature of Dgat2 .

How can researchers investigate Dgat2 protein-protein interactions?

To investigate Dgat2 protein-protein interactions, several approaches can be employed:

  • Co-immunoprecipitation: Using antibodies against Dgat2 or potential interaction partners to pull down protein complexes from cell lysates.

  • Fluorescence microscopy with tagged constructs: Employing fluorescently tagged Dgat2 variants to visualize co-localization with other proteins or cellular structures .

  • Proximity ligation assays: These can detect interactions between Dgat2 and other proteins when they are within 40 nm of each other.

  • FRET/BRET analysis: These techniques can detect direct interactions between appropriately tagged Dgat2 and other proteins in live cells.

When designing such experiments, it's important to consider that the transmembrane domains and C-terminus of Dgat2 may be involved in protein-protein interactions, so tagging strategies should be carefully selected to avoid disrupting these regions .

What are the optimal conditions for assaying recombinant mouse Dgat2 activity in vitro?

For optimal enzymatic activity assays of recombinant mouse Dgat2:

  • pH and buffer conditions: Dgat2 typically shows optimal activity at pH 7.0-7.5 in HEPES or Tris-based buffers.

  • Substrate preparation: Diacylglycerol substrates often require preparation with phospholipids to form mixed micelles or liposomes for accessibility to the enzyme.

  • Acyl-CoA selection: Dgat2 can utilize various acyl-CoA species, with a preference for unsaturated fatty acyl-CoAs (e.g., oleoyl-CoA) .

  • Detergent considerations: Low concentrations of non-ionic detergents (e.g., 0.1% Triton X-100) may be necessary to maintain enzyme solubility while preserving activity.

  • Detection methods: Activity can be measured by quantifying radioactive triglyceride formation using [14C]-labeled acyl-CoA, or through non-radioactive methods such as LC-MS/MS quantification of triglyceride products.

How can substrate specificity of Dgat2 be accurately determined?

To accurately assess Dgat2 substrate specificity:

  • Acyl-CoA preference: Test a range of acyl-CoA species varying in chain length and saturation level under identical reaction conditions.

  • Diacylglycerol preference: Compare activity with diacylglycerols containing different fatty acid compositions at the sn-1 and sn-2 positions.

  • Competitive assays: Perform assays with mixtures of different substrates to determine relative preferences when multiple substrates are available simultaneously.

  • Kinetic analysis: Determine Km and Vmax values for different substrates to quantitatively assess substrate preferences.

Mouse Dgat2, like its human homolog, may show preferences for specific acyl-CoA species, with research on related enzymes suggesting preferences for unsaturated fatty acids in the order of C18:3 > C18:2 > C18:1 > C18:0 .

How can recombinant Dgat2 mutants help elucidate structure-function relationships?

Structure-function studies using Dgat2 mutants have provided valuable insights:

  • Transmembrane domain mutants: A Dgat2 mutant lacking both transmembrane domains still maintains enzymatic activity but localizes to mitochondria rather than the ER, demonstrating that ER localization is not absolutely required for catalytic function .

  • C-terminal mutants: Truncation or deletion of C-terminal regions prevents lipid droplet association while potentially maintaining catalytic activity, indicating distinct domains for enzymatic function versus subcellular targeting .

  • Catalytic domain mutations: Targeted mutations in the acyltransferase domain can help identify specific residues involved in substrate binding and catalysis.

These approaches can be particularly valuable when designing experiments to:

  • Separate the effects of protein localization from enzymatic activity

  • Understand the contribution of different domains to substrate specificity

  • Identify potential regions for therapeutic targeting

What methods are most effective for studying Dgat2's role in lipid droplet formation?

To investigate Dgat2's role in lipid droplet formation and expansion:

  • Live cell imaging: Using fluorescently tagged Dgat2 constructs (ensuring tags don't disrupt localization signals) combined with lipid droplet stains like BODIPY or Nile Red to visualize real-time association during lipid loading .

  • Pulse-chase experiments: Employing labeled fatty acids to trace their incorporation into triglycerides and subsequent lipid droplet formation in the presence of wild-type versus mutant Dgat2.

  • Proximity labeling techniques: BioID or APEX2 fused to Dgat2 can identify proteins in close proximity at lipid droplet surfaces.

  • Correlative light and electron microscopy: This can provide ultrastructural details of Dgat2 localization during different stages of lipid droplet formation.

Research has shown that the C-terminus of Dgat2 is particularly important for lipid droplet association, as mutants with truncations or deletions in this region fail to co-localize with lipid droplets even when cells are oleate-loaded to stimulate triglyceride synthesis .

How can researchers overcome issues with recombinant Dgat2 protein aggregation?

Dgat2 aggregation can be mitigated through several approaches:

  • Optimized detergent selection: Screen multiple detergents (CHAPS, DDM, Triton X-100) at varying concentrations to find optimal solubilization conditions.

  • Expression temperature reduction: Lower expression temperatures (16-20°C) can reduce inclusion body formation in bacterial systems.

  • Fusion partners: Addition of solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO can reduce aggregation.

  • Co-expression with chaperones: Co-expressing molecular chaperones like GroEL/ES or DnaK/J can improve folding.

  • Lipid supplementation: Including phospholipids in purification buffers may help stabilize the membrane protein structure.

When aggregation cannot be completely eliminated, size exclusion chromatography should be used as a final purification step to isolate properly folded, non-aggregated protein fractions.

What are common pitfalls in interpreting Dgat2 localization studies?

When conducting and interpreting Dgat2 localization studies, researchers should be aware of several potential pitfalls:

  • Overexpression artifacts: Excessive expression can lead to mislocalization or aggregation that doesn't reflect physiological distribution. Use inducible expression systems with titrated expression levels.

  • Tagging interference: Fluorescent or epitope tags may disrupt localization signals, particularly if placed near the transmembrane domains or C-terminus. Compare N- and C-terminally tagged versions and validate with untagged protein detection .

  • Cell type variations: Dgat2 localization patterns may vary between cell types due to differences in lipid metabolism. Always relate findings to the physiological context of the cell type used.

  • Dynamic trafficking: Dgat2 localization is highly responsive to metabolic conditions, so standardizing conditions for feeding state, lipid availability, and energy status is crucial for reproducible results .

  • Fixation artifacts: Some fixation methods can disrupt membrane structures or lipid droplets. Comparing multiple fixation techniques or using live cell imaging can help validate observations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.