Recombinant Mouse DNA damage-regulated autophagy modulator protein 2 (Dram2)

Shipped with Ice Packs
In Stock

Description

Introduction to Mouse Dram2

DNA damage-regulated autophagy modulator protein 2 (Dram2) is a transmembrane lysosomal protein that plays a crucial role in the initiation of autophagy. Also known as Tmem77 (transmembrane protein 77), mouse Dram2 is a homologue of the DRAM family proteins, which are involved in the regulation of autophagy in response to cellular stress . The mouse Dram2 gene is located on the mouse genome and encodes a 267-amino acid protein containing six putative transmembrane domains . The protein is evolutionarily conserved, with homologs found across multiple species from humans to nematodes, indicating its fundamental importance in cellular processes .

Genetic Information

Mouse Dram2 has several synonyms in the scientific literature, including Tmem77, 2010305N14Rik, 2610318G18Rik, and AI647667 . The gene is transcribed ubiquitously across tissues, though with varying expression levels . The mouse Dram2 transcript variant 1 (NM_001025582) contains an open reading frame (ORF) of 540 base pairs .

Gene InformationDetails
Gene NameDram2
SynonymsTmem77, 2010305N14Rik, 2610318G18Rik, AI647667
UniProt IDQ9CR48
Full NameDNA damage-regulated autophagy modulator protein 2
ORF Size540 bp
Transcript Variant1 (NM_001025582)

Expression Systems

Recombinant mouse Dram2 protein is primarily produced using bacterial expression systems, particularly Escherichia coli (E. coli) . For research purposes, the recombinant protein is often tagged to facilitate purification and detection. Common tags include His-tag, Strep-tag, Myc-DDK-tag, and rho-1D4 tag .

Autophagy Modulation

Dram2 is primarily involved in the initiation of the autophagy process, a natural cell survival mechanism triggered in response to stress stimuli such as nutrient starvation or the accumulation of damaged organelles . Studies have shown that Dram2 initiates the conversion of endogenous LC3-I (microtubule-associated protein light chain 3) to the general autophagosome marker protein, LC3-II (LC3-1/phosphatidylethanolamine conjugate) .

The autophagy process facilitated by Dram2 involves several steps:

  1. Isolation of macromolecules and organelles within the cytoplasm into single membrane vesicles

  2. Fusion of these vesicles to produce an autophagosome

  3. Fusion of autophagosomes with lysosomes containing acid hydrolases to form double-membrane autolysosomes

  4. Degradation and recycling of cytoplasmic proteins, lipids, and organelles

Cellular Response to Stress

While the primary aim of autophagy is to relieve cellular stress, excessive induction can sometimes lead to apoptosis rather than protection from cell death . Research suggests that Dram2 may have tumor-suppressor capabilities, as evidenced by reduced Dram2 transcript and protein expression in ovarian tumors compared to normal matched tissues . Moreover, siRNA knockdown of endogenous Dram2 has been shown to result in reduced conversion to LC3-II in cells subject to starvation-induced autophagy and increased survival in deoxyrubicin-treated cells that would normally undergo p53-mediated apoptosis .

Tissue Distribution

Although Dram2 is transcribed ubiquitously across various tissues, its expression levels vary significantly between different cell types and tissues . In the context of the retina, immunohistochemical analysis has revealed specific localization patterns with important functional implications.

Retinal Localization

Confocal immunofluorescence microscopy studies on mouse retina have shown that Dram2 localizes to:

  1. The inner segment of the photoreceptor layer

  2. The apical surface of the retinal pigment epithelium (RPE), which is located at the basal and distal ends of the outer segment

This localization pattern coincides with the primary pathology observed in pre-symptomatic optical coherence tomography (OCT) analysis in human patients, where the photoreceptor layer appears specifically affected .

Retinal Dystrophies

Biallelic mutations in human DRAM2 have been associated with retinal dystrophy with early macular involvement, designated as Cone-Rod Dystrophy 21 (CORD21) . Affected individuals typically experience central visual loss in the third or fourth decade of life, with progressive loss of visual acuity. Fundus examination reveals maculopathy in all symptomatic individuals, with peripheral retinal degeneration being a frequent finding in older subjects .

The association with retinal dystrophy is consistent with Dram2's localization to photoreceptor inner segments and RPE cells, suggesting a role in photoreceptor renewal and recycling to preserve visual function .

Knockout Mouse Models

Interestingly, recent research using Dram2 knockout mice generated by CRISPR/Cas-9 technology has revealed a lack of overt retinal degeneration, contrasting with the human disease phenotype . Despite the confirmed abolishment of Dram2 expression in knockout retinas, these mice did not exhibit visible defects in photoresponse or retinal structure. No detectable loss of cone cells, changes in rhodopsin expression/localization, or signs of gliosis and apoptosis were observed . This unexpected finding emphasizes the complexity of Dram2's role in retinal physiology and pathology, suggesting potential species-specific differences or compensatory mechanisms.

Functional Assays

Recombinant mouse Dram2 protein is commonly employed in various research applications:

  • Investigating protein-protein interactions

  • Studying autophagy pathways

  • Examining retinal physiology and pathology

  • Exploring potential therapeutic targets for retinal dystrophies

Expression Studies

Plasmid constructs encoding mouse Dram2 are valuable tools for expression studies. These include the pCMV6-Entry vector system with Myc-DDK-tagged Dram2, which allows for expression in mammalian cells under kanamycin/neomycin selection .

Reconstitution Guidelines

For optimal use of lyophilized recombinant Dram2 protein, providers recommend:

  1. Brief centrifugation prior to opening to bring contents to the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C

  4. Avoiding repeated freeze-thaw cycles

Future Research Directions

The discrepancy between human DRAM2 mutations causing retinal dystrophy and the lack of retinal degeneration in Dram2 knockout mice presents an intriguing area for future research . Several unresolved questions warrant further investigation:

  1. The species-specific differences in Dram2 function between humans and mice

  2. Potential compensatory mechanisms that may prevent retinal degeneration in knockout mice

  3. The precise role of Dram2 in photoreceptor renewal and recycling

  4. The interplay between Dram2-mediated autophagy and ciliogenesis in photoreceptors

  5. The potential of Dram2 as a therapeutic target for retinal dystrophies

As research technologies advance, further studies will likely elucidate the complex role of Dram2 in retinal physiology and pathology, potentially leading to novel therapeutic approaches for retinal dystrophies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Dram2; Tmem77; DNA damage-regulated autophagy modulator protein 2; Transmembrane protein 77
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Dram2
Target Protein Sequence
MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISDTGTIPPERCLFGVML NIAAVLGIATMYVRYKQVHALNPEENLIIKLNKAGLVLGILSCLGLSLVANFQKSTLFIV HVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLVIWCGVSALSMMTCSSIL YSSDFGPDVVQKLHWNPEDKGYVLHLVTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEAN LHGLTLYDTVPCPVNNERTPLLSRDFQ
Uniprot No.

Target Background

Function
DRAM2 plays a crucial role in the initiation of autophagy. In the retina, it may be involved in the renewal and recycling of photoreceptor cells, contributing to the preservation of visual function. When co-expressed with DRAM1, it induces apoptotic cell death.
Database Links
Protein Families
DRAM/TMEM150 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Photoreceptor inner segment. Apical cell membrane.
Tissue Specificity
Expressed in the retina.

Q&A

What is mouse Dram2 and what are its structural characteristics?

Dram2 (DNA damage-regulated autophagy modulator 2), also known by synonyms 2010305N14Rik, 2610318G18Rik, AI647667, and Tmem77, is a protein that functions as an autophagy modulator. The mouse Dram2 gene (transcript variant 1) has an ORF size of 540 bp and encodes a 180 amino acid protein with six putative transmembrane domains . The protein shares homology with DRAM1, which is a known p53-cell death regulator, but Dram2's precise cellular function remains somewhat controversial, with proposed roles in cell death, autophagy, and inflammation . The protein is primarily localized to lysosomes, but its distribution varies by cell type and tissue.

What are the known functions of Dram2 in cellular processes?

Dram2 has been implicated in several cellular processes, though its exact role remains under investigation. Current evidence suggests Dram2 functions in:

  • Autophagy regulation: As a homologue of DRAM1, Dram2 can induce autophagy processes, though through potentially different mechanisms .

  • Cell death regulation: Dram2 has been linked to cell death pathways, with its loss in post-mitotic cells like photoreceptors and RPE cells increasing susceptibility to stress-induced death .

  • Proliferation control: Interestingly, Dram2 loss shows cell type-specific effects, providing a proliferative advantage to choroidal cells while increasing degeneration susceptibility in non-dividing cells .

  • Inflammatory response: Recent studies have implicated Dram2 in inflammation regulation .

The seemingly contradictory functions highlight the context-dependent role of Dram2, which appears to be influenced by cell type, developmental stage, and environmental factors.

What approaches are recommended for generating Dram2 knockout mouse models?

Based on recent successful studies, CRISPR/Cas9 technology has proven effective for generating Dram2 knockout mice . When designing your knockout strategy:

  • Target conserved exons that are present in all known splice variants to ensure complete loss of function.

  • Confirm knockout efficiency through multiple validation methods:

    • Western blot analysis to verify absence of the protein

    • RT-PCR to confirm disruption of mRNA expression

    • Immunostaining to validate protein loss in specific tissues of interest

For retinal studies specifically, researchers have successfully created Dram2 knockout models that completely abolished DRAM2 expression in retinal tissues . Validation should include structural analysis of target tissues and functional assessment (such as ERG for retinal studies) to determine phenotypic effects.

What expression systems are available for recombinant mouse Dram2 production?

For researchers requiring recombinant Dram2 protein, tagged expression systems provide flexibility for detection and purification. Available options include:

  • Mammalian expression systems: The pCMV6-Entry vector system with C-terminal tags (such as Myc-DDK) has been validated for mouse Dram2 expression . This system includes:

    • Neomycin selection for stable mammalian cell transfection

    • Kanamycin (25 μg/mL) selection for E. coli propagation

    • SgfI-MluI restriction sites for cloning

  • Strategic considerations for expression:

    • The full ORF sequence (540 bp) should be verified before experimental use

    • When designing expression constructs, consider that Dram2 is a transmembrane protein, which may affect solubility and folding

    • For localization studies, C-terminal tags are generally preferred as they have been shown to maintain proper membrane insertion

What phenotypic analysis methods should be employed when studying Dram2 knockout models?

Based on published research methodologies, comprehensive phenotypic analysis of Dram2 knockout models should include:

  • Functional assessments:

    • Electroretinogram (ERG) using systems like the Celeris electrophysiology platform to measure retinal response

    • Photoresponse testing under various light intensities (0.001-0.1 range has been validated)

  • Structural analysis:

    • Histological examination of retinal layers, measuring outer nuclear layer (ONL), inner segment (IS), and outer segment (OS) thickness

    • Immunostaining analysis using antibodies against cell-specific markers (e.g., cone opsins for cone cells, rhodopsin for rod cells)

  • Cellular health markers:

    • Assessment of gliosis (using GFAP markers)

    • Apoptosis detection (TUNEL assay)

    • Expression and localization of membrane disc proteins

Remember that age-matched controls are essential, as some Dram2-related phenotypes may be age-dependent, manifesting only in older animals .

How does Dram2 function differ between retinal cell types?

Research reveals intriguing cell type-specific functions of Dram2 that may explain its complex role in retinal health:

  • In photoreceptors and RPE cells (post-mitotic cells):

    • Dram2 loss increases susceptibility to stress-induced cell death

    • Dram2 appears essential for long-term survival, with age-related photoreceptor degeneration observed in some knockout models

    • Located in the inner segment of photoreceptors and apical surface of RPE cells

  • In choroidal cells (mitotic capacity):

    • Dram2 loss provides a proliferative advantage

    • Knockout mice show increased proliferation of choroidal cells in vitro

    • Dram2 loss exacerbates choroidal neovascular lesions in vivo

This dichotomy suggests Dram2 functions differ fundamentally between proliferative and post-mitotic cells, potentially explaining why simple knockout models may not fully recapitulate human disease. When designing experiments, cell type-specific conditional knockouts might provide more precise insights than global knockout approaches.

What is the relationship between Dram2 and autophagy in retinal health?

While Dram2 is classified as an autophagy modulator, its precise mechanism in autophagy regulation remains incompletely understood, particularly in retinal tissues:

  • Lysosomal localization: Dram2 localizes to lysosomes, suggesting a role in the terminal stages of autophagy

  • Context-dependent effects: Unlike its homologue DRAM1, which has well-established autophagy induction capabilities, Dram2's role appears more complex and potentially tissue-specific

  • Research approaches: To investigate Dram2's role in retinal autophagy:

    • Measure autophagy markers (LC3-II, p62) in Dram2-deficient versus wild-type retinal tissues

    • Employ autophagy flux assays using bafilomycin A1 or chloroquine to block lysosomal degradation

    • Examine autophagosome formation using transmission electron microscopy

    • Analyze autophagy responses under stress conditions (e.g., nutrient deprivation, oxidative stress)

Current evidence suggests that the autophagy-modulating function of Dram2 may be particularly important under stress conditions rather than in basal homeostasis, explaining why some knockout models show limited phenotypes under normal conditions .

How can the contradiction between human DRAM2 pathology and mouse model findings be explained?

One of the most intriguing questions in Dram2 research is the apparent contradiction between human and mouse pathology:

  • Human pathology: Pathogenic variants of DRAM2 cause autosomal recessive Cone-rod dystrophy 21 (CORD21), characterized by decreased visual acuity, color vision deficits, photophobia, and decreased central visual field sensitivity

  • Mouse model findings: Dram2 knockout mice reportedly lack overt retinal degeneration, with:

    • No visible defects in photoresponse

    • Normal retinal structure

    • No detectable loss of cone cells

    • Normal expression and localization of rhodopsin and membrane disc proteins

    • No evidence of gliosis or apoptosis

This discrepancy might be explained by:

  • Species-specific differences: Human and mouse retinas have different structural and functional characteristics, particularly regarding cone density and distribution

  • Compensatory mechanisms: Mice may have redundant pathways that compensate for Dram2 loss

  • Age and environmental factors: Human pathology develops over decades, while mouse studies have limited timeframes

  • Mutation type: Complete Dram2 ablation in knockout mice may produce different effects than the specific pathogenic variants found in humans

  • Developmental timing: Constitutive knockout from embryonic stages may engage compensatory mechanisms not available when the gene is lost later in life

To address this contradiction, researchers should consider:

  • Creating knock-in mouse models with specific human pathogenic variants rather than complete knockouts

  • Extended aging studies of knockout mice

  • Combining genetic manipulation with environmental stressors

  • Using human pluripotent stem cell-derived retinal organoids with DRAM2 mutations

What are the best experimental systems for studying Dram2 function?

Different experimental systems offer complementary advantages for Dram2 research:

  • Human pluripotent stem cell (hPSC)-derived retinal organoids:

    • Advantage: Human-specific biology, ability to model developmental processes

    • Finding: DRAM2 loss causes the presence of additional mesenchymal cells

    • Method: CRISPR/Cas9-mediated DRAM2 knockout in hPSCs followed by directed differentiation to retinal organoids

  • Mouse models:

    • Advantage: In vivo system, ability to study systemic effects and aging

    • Finding: Dram2 loss causes increased proliferation of choroidal cells in vitro and exacerbates choroidal neovascular lesions in vivo

    • Method: CRISPR/Cas9-generated knockout mice with comprehensive phenotyping

  • Human RPE cell culture:

    • Advantage: Cell type-specific effects, controlled experimental conditions

    • Finding: DRAM2 loss results in increased susceptibility to stress-induced cell death

    • Method: CRISPR/Cas9-mediated knockout or siRNA knockdown in ARPE-19 or primary human RPE cells

When selecting a system, consider:

  • The specific research question (developmental processes, aging, cell-specific functions)

  • The need for human versus mouse biology

  • Availability of tools and expertise

  • Time constraints and complexity of the model system

A multi-model approach combining at least two different systems provides the most robust understanding of Dram2 function.

What controls and validation steps are essential when studying Dram2?

Rigorous experimental design for Dram2 studies should include:

  • Genetic manipulation validation:

    • Confirmation of knockout/knockdown efficiency at DNA, RNA, and protein levels

    • For CRISPR-generated models, off-target analysis and sequencing

    • For knock-in models, verification of correct mutation insertion

  • Phenotypic controls:

    • Age-matched wild-type controls from the same genetic background

    • Littermate controls whenever possible

    • For retinal studies, control for light exposure conditions

  • Functional validation:

    • For retinal studies, both structural (histology, immunostaining) and functional (ERG) assessments

    • For autophagy studies, multiple markers (LC3, p62) and flux assays

    • For cell death studies, multiple assessment methods (TUNEL, caspase activation)

  • Rescue experiments:

    • Re-expression of wild-type Dram2 in knockout models

    • For human disease variants, complementation with wild-type and mutant forms

  • Stress challenges:

    • As Dram2 function may be more critical under stress, include appropriate stress conditions:

      • Oxidative stress (H₂O₂, paraquat)

      • Nutrient deprivation

      • Light-induced damage (for retinal studies)

      • Aging as a natural stressor

What technical considerations should be addressed when expressing recombinant Dram2?

When working with recombinant Dram2 expression systems:

  • Vector selection:

    • pCMV6-Entry vector has been validated for mouse Dram2 expression

    • Consider whether constitutive or inducible expression is appropriate

    • For tissue-specific studies, select promoters with appropriate expression patterns

  • Tag considerations:

    • C-terminal tags (Myc-DDK) have been validated

    • Consider tag size and placement to minimize interference with protein function

    • For transmembrane proteins like Dram2, tag placement may affect membrane insertion

  • Sequence verification:

    • The molecular sequence should align with the gene accession number (e.g., NM_001025582)

    • Account for potential variations in individual transcript sequences due to naturally occurring polymorphisms

  • Expression optimization:

    • Codon optimization for the expression system of choice

    • Consider the need for mammalian glycosylation and post-translational modifications

    • For bacterial expression, fusion partners to enhance solubility may be necessary

  • Purification strategy:

    • For transmembrane proteins like Dram2, detergent selection is critical

    • Consider native purification versus denaturing conditions based on downstream applications

    • Validate protein folding and functionality after purification

What are the promising approaches to reconcile mouse and human Dram2 pathology?

To address the discrepancy between human DRAM2-related disease and mouse model findings:

  • Advanced genetic models:

    • Human-specific mutation knock-in models

    • Conditional and inducible knockout systems to bypass developmental compensation

    • Combined genetic and environmental models (e.g., knockout plus light damage)

  • Cross-species approaches:

    • Comparative studies using both mouse models and human stem cell-derived retinal organoids

    • Creation of "humanized" mouse models expressing human DRAM2 variants

    • Ex vivo electroporation of human DRAM2 variants into mouse retinal explants

  • Long-term aging studies:

    • Extended observation of Dram2 knockout mice beyond the timeframes reported in current literature

    • Detailed age-related changes in retinal structure and function

    • Interaction of aging with other stressors in Dram2-deficient backgrounds

  • Mechanistic investigations:

    • Identification of Dram2 interaction partners in different cell types

    • Comparative transcriptomics and proteomics between human and mouse retinal tissues

    • Exploration of species-specific compensatory pathways

These approaches may help elucidate why pathogenic DRAM2 variants cause retinal dystrophy in humans while Dram2 knockout mice show limited phenotypes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.