Recombinant Mouse DnaJ homolog subfamily C member 14 (Dnajc14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If a particular tag is required, please inform us, and we will prioritize its development.
Synonyms
Dnajc14; DnaJ homolog subfamily C member 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-703
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Dnajc14
Target Protein Sequence
MAQKHPGERRLCGAHRSGGTSLSTSGSSVDPEILSFSGLRDSAETAPNGTRCLKEHSGPK YTQPPNPAHWSDPSHGPPRGPGPPRGGGYPDESETGSEESGVDQELSRENETGYQEDGSP SFLSIPSACNCQGSPGVPEGTYSEEGDGSSSSLCHHCTSPALGEDEELEEEYDDEEPLKF PSDFSRVSSGKKPLSRRQKHRFLIKEDVRDSGRREPKAPGRHRLARKRSQTDKRRGLGLW GVEELCQLGQAGFWWLIELLVLVGEYVETCGHLIYACRKLKGSDLDLFRVWVGVWARRLG GWARMMFQFLSQSFFCVVGLLIRILRVVGAFLLLALALFLGCLQLGWRFSVGLGNRLGWR DKTAWLFSWLGSPALHHCLTLLKDSRPWQQLVRLIQWGWQELPWVKQRTKKQGNAPVASG RYCQPEEEVTRLLTMAGVPEDELNPFHVLGVEATASDTELKKAYRQLAVMVHPDKNHHPR AEEAFKILRAAWDIVSNPERRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSR CQGKHRRFEMDREPKSARYCAECNRLHPAEEGDFWAESSMLGLKITYFALMDGKVYDITE WAGCQRVGISPDTHRVPYHISFGSRVPGTSGRQRATPESPPADLQDFLSRIFQVPPGPMS NGNFFAAPHPGPGTTSTSRPNSSVPKGEAKPKRRKKVRRPFQR
Uniprot No.

Target Background

Function

Function: Regulates the export of target proteins, such as DRD1, from the endoplasmic reticulum to the cell surface.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is DNAJC14 and what is its basic function in cellular processes?

DNAJC14 (DnaJ heat shock protein family member C14) belongs to the Hsp40 chaperone family of proteins. It contains a characteristic 70-amino acid J-domain and a C-terminal domain that mediates self-interaction . As a molecular chaperone, DNAJC14 assists with Hsp70-mediated protein folding . It plays important roles in various biological processes including translation, exocytosis, and endocytosis . Additionally, DNAJC14 helps in SNARE (Soluble N-ethylmaleimide-sensitive factor activating protein receptor) complex-mediated transport by interacting with the lysosomal trafficking regulator protein .

  • How is the structure of DNAJC14 related to its function?

DNAJC14 is a Type III Hsp40 protein with structural features that determine its functionality. The protein contains:

  • A J-domain essential for its chaperone function

  • Two zinc-finger motifs downstream of the J-domain (showing similarities to Type I Hsp40s)

  • Potential transmembrane domains (TM) with predicted topology where both N and C termini are located within the cytoplasm

  • A C-terminal domain (the last 77 amino acids) that mediates self-interaction/multimerization

Mutagenesis studies have shown that both the J-domain and the C-terminal domain are required for its antiviral activity against flaviviruses . The C-terminal domain is particularly important, as deletion of the C-terminal 77 amino acids results in a protein devoid of antiviral activity .

  • What experimental approaches can be used to study DNAJC14 expression and localization in cells?

To study DNAJC14 expression and localization, researchers can employ:

  • Immunofluorescence analysis using anti-DNAJC14 antibodies to visualize endogenous DNAJC14 localization

  • Western blot analysis to detect protein expression levels

  • Epitope tagging (such as myc or GFP tags) to track recombinant DNAJC14 in cells

  • Co-immunoprecipitation assays to study protein-protein interactions

For example, researchers have used immunofluorescence analysis to demonstrate that endogenous DNAJC14 rearranges during viral infection and localizes to replication complexes identified by dsRNA staining . These approaches can provide important insights into how DNAJC14 functions in both normal cellular processes and during viral infections.

Advanced Research Questions

  • How does DNAJC14 regulate pestiviral replication, and what methods can be used to investigate this function?

DNAJC14 serves as an essential cofactor for the NS2 autoprotease of pestiviruses, regulating viral RNA replication through controlled NS2-3 cleavage :

Mechanism of regulation:

  • DNAJC14 activates the NS2 autoprotease to catalyze the release of NS3, an essential component of the viral replicase

  • Since DNAJC14 is available in limited amounts and binds tightly to NS2, NS2-3 translated later in infection is no longer cleaved

  • This leads to a shift in polyprotein processing and downregulation of RNA replication

  • This mechanism is crucial for establishing the noncytopathogenic (noncp) biotype in pestiviruses

Methodological approach to study this function:

  • Generate DNAJC14 knockout cell lines using CRISPR/Cas9 technology

  • Infect wildtype and knockout cells with various pestivirus strains

  • Monitor viral replication through:

    • Quantification of viral RNA (RT-PCR)

    • Analysis of viral protein expression (Western blotting)

    • Measurement of infectious virus production (virus titration)

  • Compare replication of different pestivirus species and biotypes (cp vs. noncp)

This approach has revealed that replication of six distinct noncp pestivirus species (A to D, F, and G) depends on DNAJC14, while cp pestiviruses replicate independently of this host factor .

  • What are the differences in DNAJC14 dependency among different members of the Flaviviridae family, and how can this be experimentally determined?

Different members of the Flaviviridae family exhibit varying dependencies on DNAJC14 for replication :

Virus GroupBiotypeDNAJC14 DependencyEvidence
Classical pestiviruses (BVDV, CSFV)NoncytopathogenicDependentCannot replicate in DNAJC14 KO cells
Classical pestivirusesCytopathogenicIndependentCan replicate in DNAJC14 KO cells
Atypical porcine pestivirus (APPV)NoncytopathogenicIndependentCan replicate in DNAJC14 KO cells
Flaviviruses (YFV, Kunjin, Langat)-Complex relationshipRequires DNAJC14 for RC formation but inhibited by overexpression
Hepacivirus (HCV)-Complex relationshipSimilar to flaviviruses

Experimental approach to determine dependency:

  • Generate DNAJC14 knockout cells using CRISPR/Cas9 (e.g., bovine MDBK and porcine SK6 cell lines)

  • Develop cells with varying DNAJC14 expression levels:

    • DNAJC14 knockout cells

    • DNAJC14 knockout cells with reintroduced DNAJC14 variants

    • Cells overexpressing DNAJC14

  • Infect these cells with different virus types/strains or transfect with viral RNA

  • Monitor viral replication using:

    • Immunofluorescence staining for viral proteins

    • RT-qPCR for viral RNA quantification

    • Virus titration assays for infectious particle production

These experiments have revealed surprising differences in DNAJC14 dependency, notably that APPV replicates efficiently in DNAJC14 knockout cells, suggesting it utilizes a different cellular protein for the adjustment of replication levels .

  • How can mutagenesis studies of DNAJC14 provide insights into its functional domains for viral inhibition?

Mutagenesis studies have been instrumental in identifying critical functional domains of DNAJC14 :

Methodological approach:

  • Generate deletion and point mutants of DNAJC14 through cloning:

    • N-terminal deletion series (NT1-NT5)

    • C-terminal deletion series (CT1-CT5)

    • Specific domain deletions (J-domain, TM domains)

    • Point mutations in key functional residues

  • Express these mutants in susceptible cells

  • Challenge the cells with virus (e.g., YFV)

  • Assess antiviral activity through:

    • Viral protein expression analysis

    • Cell protection assays

    • Viral replication measurements

Key findings from such studies:

  • Both the J-domain and C-terminal domain (last 77 amino acids) are required for anti-YFV activity

  • The C-terminal domain mediates self-interaction/multimerization, which may be important for antiviral function

  • Transmembrane domains are not strictly required for inhibition, as mutants lacking all putative TM domains (NT5) still exhibited antiviral activity

  • The antiviral effect occurs in a time- and dose-dependent manner, suggesting a stoichiometric relationship between DNAJC14 and viral proteins

These approaches can help researchers map functional domains and develop targeted interventions based on DNAJC14's structure-function relationships.

  • What techniques can be used to investigate DNAJC14 interaction with viral proteins during replication?

Several techniques can be employed to study DNAJC14-viral protein interactions :

Recommended methodological approach:

  • Co-immunoprecipitation assays:

    • Express tagged versions of DNAJC14 (myc or GFP-tagged) in cells

    • Infect cells with virus (e.g., YFV)

    • Perform immunoprecipitation using antibodies against the tag

    • Analyze co-precipitated viral proteins by Western blotting

    Protocol example: Cells can be lysed in buffer containing 10 mM HEPES, pH 7.5, 150 mM KCl, 3 mM MgCl₂, and 0.5-1% NP-40 with protease inhibitors. After clarification by centrifugation, the lysate can be incubated with appropriate antibodies (anti-myc or anti-GFP), followed by protein A/G-agarose beads. After washing, bound proteins can be analyzed by SDS-PAGE and Western blotting .

  • Confocal microscopy for co-localization studies:

    • Use fluorescently-tagged DNAJC14 or specific antibodies

    • Visualize viral replication complexes using antibodies against viral proteins or dsRNA

    • Analyze co-localization patterns

  • Proximity ligation assays to detect protein-protein interactions in situ

  • Mutational analysis to map interaction domains:

    • Generate DNAJC14 mutants with specific domain deletions

    • Test their ability to interact with viral proteins

    • Identify critical residues for interaction

These techniques have revealed that DNAJC14 is recruited to viral replication complexes during infection and interacts with nonstructural proteins, providing insight into its role in modulating viral replication .

  • How can CRISPR/Cas9-mediated knockout systems be optimized for studying DNAJC14 function in virus replication?

CRISPR/Cas9 technology has been successfully used to generate DNAJC14 knockout cell lines for studying virus-host interactions . To optimize this system:

Detailed methodological considerations:

  • Cell line selection:

    • Choose cell lines that are permissive to the virus of interest

    • Consider species-specific cell lines (e.g., bovine MDBK cells for BVDV, porcine SK6 cells for CSFV or APPV)

  • Guide RNA design:

    • Target conserved exons to ensure complete loss of function

    • Design multiple gRNAs to increase knockout efficiency

    • Verify target specificity using bioinformatic tools to minimize off-target effects

  • Validation of knockout:

    • Genomic sequencing to confirm mutations

    • Western blot analysis to verify absence of DNAJC14 protein

    • RT-PCR to confirm disruption of mRNA expression

  • Control cell generation:

    • Create matched control cells (e.g., cells expressing Cas9 without gRNA)

    • Generate rescue cell lines by reintroducing DNAJC14 variants:

      • Wild-type DNAJC14 for complementation

      • Mutant versions to identify functional domains

      • Highly active variants (e.g., Jiv90) or inactive variants (e.g., Jiv90 W29A)

  • Functional characterization:

    • Infect cells with various virus strains/species

    • Transfect with synthetic viral RNA

    • Compare replication kinetics through multiple methods

This approach has successfully demonstrated the differential requirements for DNAJC14 among pestiviruses, including the unexpected finding that APPV can replicate in DNAJC14 knockout cells .

  • What is the role of DNAJC14 in viral replication complex (RC) assembly, and how can this be investigated?

DNAJC14 plays a dual role in viral replication complex (RC) assembly - it is both required for RC formation and can interfere with RC assembly when overexpressed :

Research approach to investigate RC assembly:

  • Establish cell systems with varying DNAJC14 levels:

    • Knockdown/knockout cells (reduced levels)

    • Wild-type cells (normal levels)

    • Overexpression systems (elevated levels)

  • Analyze RC formation using:

    • Electron microscopy to visualize membranous web structures

    • Immunofluorescence to detect dsRNA and viral nonstructural proteins

    • Subcellular fractionation to isolate RC-enriched membrane fractions

    • Functional assays to measure RNA replication activity

  • Investigate time-dependent effects:

    • Early events: Initial RC formation

    • Later events: RC maturation and function

Key findings from this approach:

  • Silencing of endogenous DNAJC14 impairs YFV replication, suggesting a requirement for DNAJC14 in replication complex assembly

  • Overexpression disrupts proper stoichiometry, inhibiting viral replication

  • The inhibitory effect can be overcome when optimal ratios are restored due to accumulation of viral nonstructural proteins

  • DNAJC14 is recruited to viral replication complexes and endogenous DNAJC14 rearranges during infection

These studies provide important insights into the complex role of DNAJC14 in viral RC assembly and maturation.

  • How can comparative studies between APPV and classical pestiviruses inform our understanding of DNAJC14 function?

Comparative studies between APPV (which can replicate independently of DNAJC14) and classical pestiviruses (which require DNAJC14) offer unique insights into virus-host interactions :

Methodological approach for comparative studies:

  • Establish reverse genetics systems for both virus types:

    • Develop infectious clones for both APPV and classical pestiviruses

    • Create chimeric constructs to swap domains between viruses

    • Generate mutants affecting NS2 autoprotease function

  • Design experiments to investigate NS2-3 processing:

    • Compare NS2-3 cleavage efficiency in presence/absence of DNAJC14

    • Identify potential alternative cellular cofactors for APPV

    • Analyze the role of NS2 autoprotease in different virus contexts

  • Create and analyze engineered viral constructs:

    • Generate viral genomes with NS2 mutations affecting autoprotease activity

    • Design constructs with NS3 duplications that bypass NS2 dependency

    • Develop defective interfering genomes to study replication mechanisms

Key findings from such comparative studies:

  • APPV replication requires NS2 autoprotease activity but is independent of DNAJC14

  • Inactivation of the APPV NS2 autoprotease results in nonreplicative genomes

  • Synthetic APPV genomes with deletions and duplications leading to NS2-independent release of mature NS3 show increased replication efficiency

  • APPV likely utilizes a different cellular protein for the adjustment of replication levels

These comparative approaches have revealed important differences in cofactor requirements and suggest evolutionary divergence in replication mechanisms among pestiviruses.

  • What strategies can be employed to investigate the mechanism of DNAJC14-mediated inhibition of flavivirus replication?

DNAJC14 exhibits a dose-dependent inhibition of flavivirus replication that can be studied through various experimental approaches :

Recommended methodological strategies:

  • Time-course experiments:

    • Express DNAJC14 at different times relative to infection

    • Measure viral replication at various timepoints

    • Determine when DNAJC14 expression has the strongest inhibitory effect

  • Dose-response studies:

    • Create cell lines with varying levels of DNAJC14 expression

    • Correlate DNAJC14 expression levels with inhibition of viral replication

    • Determine the threshold level required for inhibition

  • Structure-function analysis:

    • Express various DNAJC14 mutants to identify domains critical for inhibition

    • Focus on J-domain function and C-terminal multimerization domain

    • Investigate chaperone activity vs. viral inhibition

  • Analysis of viral protein processing:

    • Determine if DNAJC14 affects viral polyprotein processing

    • Investigate whether specific viral protease activities are impacted

    • Examine the effects on complex formation between viral proteins

  • Mechanistic studies on replication complex (RC) formation:

    • Monitor the formation of viral replication complexes in the presence of varying DNAJC14 levels

    • Investigate whether DNAJC14 affects the composition of RCs

    • Analyze whether DNAJC14 alters the recruitment of viral and host factors to RCs

Expected outcomes:
These approaches can reveal whether DNAJC14 inhibition occurs at the stage of initial RC formation, affects the function of established RCs, or disrupts the proper stoichiometry of viral and host proteins required for optimal replication .

Research Applications and Methodologies

  • How can the DNAJC14-independent replication property of APPV be exploited for vaccine development?

The unique ability of APPV to replicate independently of DNAJC14 provides opportunities for vaccine development strategies :

Methodological approach for vaccine development:

  • Creation of replication-optimized APPV genomes:

    • Design synthetic APPV genomes with duplications leading to NS2-independent release of NS3

    • Test these constructs for increased replication efficiency

    • Evaluate their protein expression levels and RNA production

  • Attenuation strategies:

    • Introduce targeted mutations in viral genes to reduce virulence while maintaining immunogenicity

    • Test combinations of NS3 duplication with attenuating mutations

    • Evaluate stability of attenuated constructs over multiple passages

  • Safety and efficacy testing:

    • Verify non-reversion to virulent phenotype

    • Assess immunogenicity in appropriate animal models

    • Evaluate protection against challenge with virulent APPV strains

  • Application to other pestiviruses:

    • Explore whether insights from APPV can be applied to develop new vaccine approaches for classical pestiviruses

    • Test chimeric constructs combining DNAJC14-independent properties of APPV with antigenic regions of other pestiviruses

The replication-optimized synthetic APPV genomes might serve as suitable live vaccine candidates, as they show increased replication and antigen expression without causing cytopathic effects in cultured cells .

  • What experimental design would be most effective for identifying alternative cellular cofactors that might regulate APPV NS2 autoprotease activity?

Since APPV replicates independently of DNAJC14 but still requires NS2 autoprotease activity, it likely utilizes alternative cellular cofactors . An effective experimental design to identify these factors would include:

Comprehensive identification strategy:

  • Affinity purification coupled with mass spectrometry:

    • Express tagged APPV NS2 protein in relevant cell lines

    • Perform pull-down assays to isolate NS2-interacting proteins

    • Identify binding partners by mass spectrometry

    • Compare with known DNAJC14-NS2 interaction patterns from classical pestiviruses

  • Genome-wide CRISPR screens:

    • Develop a reporter system for APPV replication

    • Perform genome-wide CRISPR knockout screen to identify genes essential for APPV replication

    • Focus on genes encoding chaperones or proteins involved in protein folding

  • Candidate approach based on structural similarities:

    • Identify proteins with structural similarities to DNAJC14

    • Focus on other J-domain containing proteins

    • Test their ability to complement NS2 autoprotease function

  • Validation of identified candidates:

    • Generate knockout cell lines for promising candidates

    • Test APPV replication in these cells

    • Perform rescue experiments by reintroducing the candidate genes

    • Evaluate direct interaction with APPV NS2 using co-immunoprecipitation

  • Functional characterization:

    • Determine if the identified cofactor activates the NS2 autoprotease

    • Investigate whether the cofactor affects NS2-3 cleavage efficiency

    • Assess the role of the cofactor in regulating viral RNA replication levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.