Recombinant Mouse DnaJ homolog subfamily C member 18 (Dnajc18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Dnajc18; DnaJ homolog subfamily C member 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Dnajc18
Target Protein Sequence
MATTLGSGERWTQAYIDAIRRNKYPEDKRPDSHDPCGCCNCMKAQKEKKSENEWNQTRQG EGNATYTEEQLRGVQRIKKCRNYYDILGVSHNASDEELKKAYKKLALKFHPDKNCAPGAT EAFKAIGNAFAVLSNPDKRLRYDEYGDEQVTFTVPRARSYHYYKDFEADISPEELFNVFF GGHFPSGNIHMFSNVTDDSQYYRRRHRHERTQTHKREEDKSQTPYSAFVQLLPVLVIVTI SVITQLLAANPPYSLFYKSTLGYTISRETQNLQVPYFVDKNFDKAYRGASLRDLEKTIEK DYIDYIQTSCWKEKQQKSELTNLAGLYRDERLRQKAESLKLENCAKLSKLIGLRRAG
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the tissue-specific expression pattern of Dnajc18?

Studies have revealed that Dnajc18 exhibits a highly specific expression pattern in mammalian tissues. In rat models, Northern blot analysis demonstrated that Dnajc18 mRNA is expressed exclusively in testis and begins to express from postnatal week 4, with strongest expression in adult testis .

Further characterization through in situ hybridization showed that Dnajc18 mRNA is specifically expressed during the maturation stages of germ cells, particularly in:

  • Late pachytene spermatocytes

  • Round spermatids

  • Elongated spermatids

This tissue-specific expression pattern suggests a specialized role for Dnajc18 in spermatogenesis and germ cell maturation, distinguishing it from many other heat shock proteins that show more ubiquitous expression patterns.

What is the subcellular localization of Dnajc18 protein?

Confocal microscopy studies using GFP-tagged Dnajc18 protein have demonstrated that it primarily localizes to the cytoplasm of cells . This cytoplasmic localization is consistent with its presumed function as a molecular chaperone involved in protein folding and quality control.

Unlike some other DnaJ family members that may be targeted to specific organelles or the nucleus, Dnajc18 appears to function primarily in the cytosolic compartment, where it likely interacts with Hsp70 and client proteins during folding processes.

What are the optimal expression systems for recombinant Mouse Dnajc18 production?

Multiple expression systems have been successfully employed for Dnajc18 production, each with specific advantages:

Expression SystemHostPurification TagPurityApplicationsReference
MammalianHEK-293 CellsHis tag>90%Functional studies, structural analysis
Cell-free protein synthesisCFPSStrep Tag>70-80%ELISA, WB, SDS
Wheat germN/AGST tagVariableELISA, WB, AP

For optimal functional studies, HEK-293 mammalian expression systems have demonstrated superior results for Dnajc18, yielding proteins with higher purity (>90% as determined by Bis-Tris PAGE, anti-tag ELISA, Western Blot and analytical SEC) . The mammalian system is particularly valuable for ensuring proper folding and potential post-translational modifications that may be critical for the protein's activity.

For experiments requiring rapid production or when studying specific domains, cell-free protein synthesis systems can be advantageous, though they typically yield protein with slightly lower purity (70-80%) .

What are the recommended methods for detecting endogenous and recombinant Dnajc18?

Several validated methods have been established for detecting Dnajc18 in experimental settings:

Western Blot Analysis:

  • Optimal primary antibody dilution: 1:500 for rabbit anti-Dnajc18 antibodies

  • Detection of a specific band at approximately 41.2 kDa

  • Recommended positive control: Adult testis tissue lysate

  • Loading control: α-tubulin (1:2000 dilution)

Immunohistochemistry:

  • Optimal antibody dilution: 1:300 in blocking solution

  • Sample preparation: 6 µm thick paraffin-embedded tissue sections

  • Blocking: 2% normal rabbit serum (NRS) in PBS for 1 hour

  • Incubation: Overnight at 4°C

In Situ Hybridization:

  • Probe preparation: [35S]-labeled cDNA fragments

  • Hybridization conditions: 52-55°C overnight in 50% formamide buffer

  • Post-hybridization stringency: 0.1× SSC

  • Exposure time: 2 weeks at 4°C for autoradiography

Each of these methods has been validated in published studies and provides complementary information about Dnajc18 expression and localization.

How can I validate the specificity of antibodies against Dnajc18?

Antibody specificity validation is critical for reliable experimental results. For Dnajc18, the following validation approaches are recommended:

  • Western blot with recombinant protein controls:

    • Use in vitro translated Dnajc18 protein as a positive control

    • Compare with lysates from tissues known to express and not express Dnajc18

    • Verify the correct molecular weight band (41.2 kDa)

  • Peptide competition assay:

    • Pre-incubate the antibody with the immunizing peptide

    • The specific signal should be abolished by peptide competition

  • Knockout or knockdown validation:

    • Similar to approaches used for HSP40/DNAJB1 antibody validation

    • Compare antibody reactivity in wild-type versus Dnajc18 knockout/knockdown samples

  • Cross-reactivity testing:

    • Test antibody reactivity against other closely related DnaJ family members

    • Ensure specificity for Dnajc18 versus other subfamily members

  • Multiple antibody concordance:

    • Compare results using antibodies raised against different epitopes of Dnajc18

    • Consistent results with different antibodies increase confidence in specificity

How can I design experiments to investigate Dnajc18's role in spermatogenesis?

Given the specific expression of Dnajc18 in testicular tissue during spermatogenesis, the following experimental approaches are recommended for investigating its role:

  • Temporal expression analysis:

    • Collect testis samples at different developmental stages (prepubertal to adult)

    • Perform quantitative RT-PCR and Western blot analysis

    • Correlate Dnajc18 expression with specific stages of spermatogenesis

  • Cell-type specific isolation:

    • Use techniques such as laser capture microdissection or FACS sorting

    • Isolate specific populations of germ cells (spermatogonia, spermatocytes, spermatids)

    • Analyze Dnajc18 expression in purified cell populations

  • Co-immunoprecipitation studies:

    • Identify Dnajc18 interaction partners in testicular tissues

    • Focus on potential interactions with other chaperones (e.g., Hsp70) and client proteins

    • Use GFP-Dnajc18 fusion constructs for pull-down experiments

  • Functional knockdown/knockout:

    • Design conditional knockout models to avoid potential developmental effects

    • Analyze spermatogenesis progression, sperm count, and morphology

    • Perform fertility assessments to determine functional consequences

  • Stress response experiments:

    • Subject testicular tissues or cells to various stressors (heat, oxidative stress)

    • Evaluate changes in Dnajc18 expression and localization

    • Determine if Dnajc18 provides protective effects during stress conditions

These methodological approaches allow for comprehensive investigation of Dnajc18's specific role in spermatogenesis, moving beyond correlative observations to establish causative relationships.

What are the emerging connections between Dnajc18 and cardiac function?

Recent research has identified Dnajc18 as a potential contributor to cardiac development and function:

  • Structural cardiac development:

    • Dnajc18 gene knockout mouse lines have been shown to exhibit developmental cardiac structural abnormalities

    • These findings categorize DNAJC18 as a variant of unknown relevance (VUR) in congenital heart disease

  • Human clinical correlations:

    • Analysis of UK Biobank data validated the importance of DNAJC18 for cardiac homeostasis

    • Loss of function mutations in DNAJC18 were associated with altered left ventricular systolic function

  • Experimental approaches to investigate cardiac roles:

    • Echocardiography of Dnajc18-null mice to assess functional parameters

    • Microcomputed tomography imaging to detect structural abnormalities

    • Molecular characterization of downstream signaling pathways affected by Dnajc18 deficiency

This emerging connection between Dnajc18 and cardiac function represents an important new direction for research, suggesting that its chaperone activity may be critical in multiple specialized tissues beyond the previously established testicular expression.

How can I design experiments to characterize Dnajc18's molecular chaperone activity?

To thoroughly characterize the molecular chaperone function of Dnajc18, consider the following experimental approaches:

  • ATPase stimulation assays:

    • Measure the ability of purified Dnajc18 to stimulate the ATPase activity of Hsp70

    • Use recombinant proteins and spectrophotometric methods to quantify ATP hydrolysis rates

    • Compare with other DnaJ family members as controls

  • Protein folding assays:

    • Utilize denatured substrate proteins (e.g., luciferase, citrate synthase)

    • Monitor refolding kinetics in the presence of Dnajc18 alone or with Hsp70

    • Assess prevention of aggregation under stress conditions

  • Domain function analysis:

    • Generate deletion mutants lacking specific domains

    • Assess the contribution of each domain to chaperone activity

    • Identify regions essential for interaction with Hsp70 versus client proteins

  • Client protein identification:

    • Perform co-immunoprecipitation followed by mass spectrometry

    • Use proximity labeling techniques (BioID, APEX) to identify interacting proteins

    • Validate interactions through reciprocal pull-downs and functional assays

  • Structural studies:

    • Employ X-ray crystallography or cryo-EM to determine protein structure

    • Analyze conformational changes during chaperone cycle using FRET or other techniques

    • Compare structural features with other DnaJ subfamily members

These approaches will provide comprehensive characterization of Dnajc18's molecular function and place it in context with other members of the diverse DnaJ protein family.

How should I troubleshoot low expression yields of recombinant Dnajc18?

Low expression yields of recombinant Dnajc18 can result from several factors. Here's a systematic troubleshooting approach:

  • Expression system evaluation:

    • Mammalian expression systems (HEK-293 cells) typically yield higher-quality Dnajc18 protein

    • If using E. coli, consider switching to mammalian or insect cell systems

    • For difficult constructs, cell-free protein synthesis may be advantageous

  • Codon optimization:

    • Ensure the coding sequence is optimized for the expression host

    • Analyze GC content and rare codon usage

    • Consider synthetic gene synthesis with optimized codons

  • Solubility enhancement strategies:

    • Test different fusion tags (His, GST, MBP) to improve solubility

    • Optimize buffer conditions during purification

    • Consider expressing specific domains rather than full-length protein

    • Adjust induction temperature and time to favor proper folding

  • Protein stability considerations:

    • Include protease inhibitors during purification

    • Analyze potential degradation by SDS-PAGE

    • Optimize storage conditions (buffer composition, pH, glycerol content)

    • Store at -80°C for extended periods

  • Purification optimization:

    • Implement multi-step purification (affinity chromatography followed by size exclusion)

    • Verify protein identity by mass spectrometry

    • Assess protein quality by analytical SEC (HPLC)

Following these systematic approaches can significantly improve recombinant Dnajc18 protein yields and quality for downstream applications.

How can I interpret contradictory results between in vitro and in vivo Dnajc18 studies?

Discrepancies between in vitro and in vivo findings for Dnajc18 may arise from several factors:

  • Context-dependent functions:

    • In vitro systems lack the complex cellular environment

    • Dnajc18 may require specific co-factors or interacting partners present only in vivo

    • Consider complementary approaches that bridge in vitro and in vivo systems (e.g., cell-based assays)

  • Expression level differences:

    • Overexpression in vitro may lead to non-physiological interactions

    • Endogenous expression levels in vivo are precisely regulated

    • Use inducible expression systems with titratable control to match physiological levels

  • Post-translational modifications:

    • Important modifications may be absent in recombinant proteins

    • Characterize the post-translational modification status of native versus recombinant Dnajc18

    • Use mass spectrometry to identify and compare modifications

  • Tissue-specific factors:

    • Dnajc18 shows tissue-specific expression (testis, cardiac tissue)

    • Consider using tissue-relevant cell lines or primary cells for in vitro studies

    • Examine expression patterns in different tissues to guide experimental design

  • Temporal dynamics:

    • In vivo expression follows developmental timing (e.g., postnatal week 4 in testis)

    • Design time-course experiments to capture temporal dynamics

    • Compare developmental stages in vivo with differentiation models in vitro

Addressing these factors systematically can help reconcile contradictory results and develop a more complete understanding of Dnajc18 function.

What are the most promising approaches for investigating Dnajc18's role in congenital heart disease?

The recent identification of Dnajc18 as a potential contributor to congenital heart disease opens several promising research avenues:

  • Genotype-phenotype correlation studies:

    • Screen for DNAJC18 mutations in congenital heart disease patient cohorts

    • Correlate specific mutations with clinical phenotypes

    • Use CRISPR-Cas9 to introduce equivalent mutations in model organisms

  • Developmental timing analysis:

    • Characterize the expression pattern of Dnajc18 during cardiac development

    • Implement inducible knockout systems to disrupt function at specific developmental stages

    • Identify critical windows when Dnajc18 function is essential for proper cardiac development

  • Cell type-specific requirements:

    • Implement conditional knockout strategies targeting specific cardiac cell types

    • Determine if Dnajc18 is required in cardiomyocytes, fibroblasts, or endothelial cells

    • Use single-cell RNA-seq to identify cell populations expressing Dnajc18 during development

  • Pathway integration:

    • Identify signaling pathways affected by Dnajc18 deficiency

    • Investigate potential interactions with known cardiac development regulators

    • Perform rescue experiments to place Dnajc18 within developmental pathways

  • Translational approaches:

    • Develop zebrafish models for high-throughput screening of potential therapeutics

    • Investigate whether modulating Hsp70 activity can compensate for Dnajc18 deficiency

    • Explore gene therapy approaches for DNAJC18-associated cardiac defects

These multifaceted approaches would significantly advance our understanding of Dnajc18's role in cardiac development and potential therapeutic strategies for associated congenital defects .

How might integration of structural and functional studies enhance our understanding of Dnajc18?

Integrating structural and functional approaches would substantially advance Dnajc18 research:

  • Structure-function correlations:

    • Determine the high-resolution structure of Dnajc18 using X-ray crystallography or cryo-EM

    • Identify structural features that distinguish it from other DnaJ family members

    • Map functional domains to specific structural elements

  • Interaction interface mapping:

    • Characterize the binding interface between Dnajc18 and Hsp70

    • Identify surfaces involved in client protein recognition

    • Use site-directed mutagenesis to validate key interaction residues

  • Conformational dynamics:

    • Investigate potential conformational changes during the chaperone cycle

    • Apply techniques like hydrogen-deuterium exchange mass spectrometry

    • Determine if tissue-specific interactions induce structural rearrangements

  • In silico modeling and predictions:

    • Employ molecular dynamics simulations to predict protein behavior

    • Use computational approaches to identify potential binding partners

    • Model the effects of disease-associated mutations on protein structure

  • Integrated multi-omics approach:

    • Combine structural data with proteomics, transcriptomics, and functional assays

    • Develop predictive models of Dnajc18 activity in different cellular contexts

    • Validate computational predictions with targeted experimental approaches

This integrated approach would provide a comprehensive understanding of how Dnajc18 structure determines its specialized functions in different tissues and developmental contexts.

How can I establish effective collaborations for comprehensive Dnajc18 research?

Dnajc18 research spans multiple disciplines, making collaborative approaches particularly valuable:

  • Interdisciplinary team building:

    • Combine expertise in structural biology, developmental biology, and clinical genetics

    • Engage reproductive biologists for spermatogenesis studies

    • Partner with cardiovascular specialists for cardiac function investigations

  • Technology sharing platforms:

    • Establish material transfer agreements for sharing Dnajc18 reagents

    • Develop repositories for validated antibodies, expression constructs, and knockout models

    • Implement standardized protocols to ensure reproducibility across laboratories

  • Collaborative funding strategies:

    • Identify funding mechanisms that support multi-institutional research

    • Develop grant proposals that integrate basic science with clinical applications

    • Leverage core facilities at partner institutions for specialized techniques

  • Data integration frameworks:

    • Implement consistent data formats and sharing protocols

    • Develop databases that integrate diverse Dnajc18-related datasets

    • Use machine learning approaches to identify patterns across experimental systems

  • Translational research partnerships:

    • Connect basic researchers with clinical investigators studying relevant conditions

    • Establish biobanks of patient samples with potential DNAJC18 mutations

    • Develop pipelines for functional validation of variants identified in patients

These collaborative approaches can accelerate discovery and translate findings into clinical applications more efficiently than isolated research efforts.

What are the potential synergies between Dnajc18 research and broader studies of molecular chaperones?

Dnajc18 research can both benefit from and contribute to the broader field of molecular chaperone biology:

  • Comparative functional analysis:

    • Investigate how Dnajc18 differs from other DnaJ proteins in substrate specificity

    • Determine whether it cooperates with specialized Hsp70 variants

    • Explore potential redundancy or compensation among DnaJ family members

  • Chaperone networks in specialized tissues:

    • Map the complete chaperone network in tissues where Dnajc18 is expressed

    • Identify tissue-specific co-chaperones that modify Dnajc18 function

    • Determine how Dnajc18 integrates into the broader proteostasis network

  • Evolution of specialized chaperone functions:

    • Compare Dnajc18 sequences and functions across species

    • Investigate when tissue-specific expression patterns emerged

    • Determine if Dnajc18 represents convergent or divergent evolution of chaperone functions

  • Therapeutic targeting strategies:

    • Apply insights from broader chaperone-targeting therapeutics

    • Explore whether Dnajc18 modulation could provide tissue-specific intervention

    • Develop screening platforms for compounds that selectively affect Dnajc18 function

  • Systems biology integration:

    • Position Dnajc18 within comprehensive models of cellular proteostasis

    • Investigate how Dnajc18 contributes to resilience against proteotoxic stress

    • Determine whether Dnajc18 dysfunction contributes to protein aggregation disorders

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.