Recombinant Mouse DnaJ homolog subfamily C member 25 (Dnajc25)

Shipped with Ice Packs
In Stock

Description

General Information

Dnajc25 is a member of the DnaJ heat shock protein family (Hsp40) . DnaJ proteins function as chaperones, assisting in protein folding and preventing protein aggregation . They interact with Hsp70 proteins, enhancing their ATPase activity and substrate binding .

Expression and Localization

The expression pattern of DnaJ proteins such as msj-1 is consistent with a role in spermiogenesis .

Functional Significance

DnaJ homologs like DjA1 and DjA2 are involved in protein folding and mitochondrial protein import . They act as co-chaperones of Hsp70s . DjA1 regulates androgen receptor signaling and is critical in spermiogenesis, although DjA1 and DjA2 are not functionally equivalent in vivo .

DnaJc25 in Breast Cancer

Dnajc25 has been identified as a candidate tumor suppressor gene in breast cancer .

  • Expression Levels: Clinical breast cancer samples show reduced levels of DNAJC25 mRNA relative to normal samples .

  • Survival: High DNAJC25 expression is favorable for post-progression survival in breast cancer .

  • Genetic/Epigenetic Alterations: Point mutations or copy number variations of DNAJC25 are uncommon in clinical breast cancer samples. The DNAJC25 promoter is not methylated in breast cell lines, with promoter hypomethylation observed in normal and tumor clinical samples .

4.1. Expression in Breast Cancer Cell Lines

DNAJC25 mRNA level is significantly reduced in the MDA-MB-231 breast cancer cell line compared to the non-tumorigenic mammary epithelial cell line (MCF 10A) . BT-20 and ZR-75-1 cell lines have significantly high levels of DNAJC25 mRNA .

4.2. mRNA Expression in Clinical Samples

DNAJC25 mRNA expression is reduced in clinical breast cancer samples compared to normal samples . HER2+ and Triple-Negative Breast Cancer (TNBC) clinical tumor samples have significantly low levels of DNAJC25 mRNA compared to normal samples .

4.3. Survival Analysis

High DNAJC25 expression is favorable for post-progression survival in breast cancer . High DNAJC25 mRNA expression is favorable for luminal A subtype in DMFS and PPS and for HER2+ subtype in DMFS, but unfavorable for luminal B subtype in RFS and DMFS, and for basal subtype in DMFS .

Genetic Information

  • UniGene: Mm.317801

  • KEGG: mmu:72429

  • STRING: 10090.ENSMUSP00000092680

  • NCBI Gene ID: 72429

Recombinant Mouse DnaJc25 Availability

Recombinant Mouse DnaJ homolog subfamily C member 25 (Dnajc25) is available for purchase from various sources, including Cusabio . It is produced in Yeast, E. coli, Baculovirus, and Mammalian cells .

Further Reading and Research

To further explore the functions, interactions, and implications of Dnajc25, consider the following steps:

  • Consulting Databases: Explore resources such as NCBI Gene, UniGene, KEGG, and STRING to gather comprehensive information on the gene, its pathways, and related molecules .

  • Reviewing Literature: Conduct a thorough search of scientific publications in databases like PubMed, Google Scholar, and Web of Science to find detailed studies, experimental data, and clinical findings related to Dnajc25.

  • Analyzing Expression Data: Utilize tools like the Human Protein Atlas to understand the tissue-specific expression patterns of DNAJC25 .

  • Accessing Recombinant Proteins: Check online catalogs such as CUSABIO for availability of recombinant proteins for experimental use .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Dnajc25; DnaJ homolog subfamily C member 25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Dnajc25
Target Protein Sequence
MAARLALRGGPGAAGQRPWLLLAPLLLVPLLARPAEALVEGLYCGTRDCYEVLGVSRSAS KAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAEAFLLVATAYETLKDEETRKDYDYM LDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISMFQYFSWWNSYNKAISYLATVPK YRIQATEIAKEQGLLKKAKEKGKNKKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVRD LLLFQVILAPVHLCSYIAWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMSQSQFDSLEDH QKEMFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD
Uniprot No.

Target Background

Database Links
Protein Families
DNAJC25 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is mouse Dnajc25 and what cellular functions does it serve?

Mouse Dnajc25 (DnaJ homolog subfamily C member 25) is a member of the highly conserved DnaJ/Hsp40 family of proteins that function as co-chaperones for Hsp70 proteins. These proteins typically contain a J-domain that stimulates the ATPase activity of Hsp70 chaperones, facilitating protein folding, transport, and degradation pathways. Mouse Dnajc25 shares approximately 98% sequence identity with its human ortholog , suggesting strong evolutionary conservation and likely similar functional roles across mammalian species. The protein is encoded by a protein-coding gene and plays roles in protein quality control and cellular stress responses. Unlike some DnaJ subfamily members with tissue-specific expression patterns (such as Dnajc5b which shows restricted expression in testis) , Dnajc25 demonstrates a broader expression profile across multiple tissues.

How does mouse Dnajc25 differ from other DnaJ subfamily members?

Mouse Dnajc25 differs from other DnaJ subfamily members in several key aspects:

  • Structural characteristics: Unlike Dnajc5b which has a molecular mass of 23.1 kDa , Dnajc25 has distinct domain architecture and molecular weight.

  • Expression pattern: While some DnaJ proteins show highly tissue-specific expression (such as Dnajc5b with restricted expression toward testis in adults) , Dnajc25 exhibits a broader tissue distribution.

  • Evolutionary conservation: Mouse Dnajc25 shows remarkably high sequence conservation with human (98%) and rat (98%) orthologs , suggesting critical functional roles maintained throughout mammalian evolution.

  • Genomic organization: Interestingly, human DNAJC25 has been documented to form co-transcribed mRNAs with the neighboring GNG10 gene, resulting in fusion proteins that combine the N-terminus of DNAJC25 and the C-terminus of GNG10 . Similar genomic arrangements may exist in the mouse ortholog, representing a unique feature compared to other DnaJ subfamily members.

DnaJ Subfamily MemberMolecular WeightPrimary ExpressionNotable Features
Dnajc25Variable based on isoformsBroad tissue distributionHigh conservation (98%) with human ortholog; potential for fusion transcripts
Dnajc5b23.1 kDaRestricted to testis (RPKM 67.1)Functions as cysteine string protein beta (CSP-beta)

What expression vectors are commonly used for recombinant mouse Dnajc25 production?

For recombinant mouse Dnajc25 production, several expression vector systems can be employed depending on the experimental goals:

  • Mammalian expression systems: For authentic post-translational modifications and proper folding, vectors like pcDNA3.1 with C-terminal tags (such as DDK/Myc) are commonly used. These systems are particularly valuable when studying protein-protein interactions or subcellular localization .

  • Bacterial expression systems: For high-yield protein production aimed at structural studies or antibody generation, pET-based vectors with affinity tags (His, GST) can be utilized, though with the caveat that proper folding may be compromised.

  • Insect cell expression systems: Baculovirus expression systems provide a middle ground with higher protein yields than mammalian cells while maintaining most post-translational modifications.

When designing expression constructs, researchers should consider incorporating epitope tags (such as Myc/DDK as seen with other DnaJ family members) to facilitate detection and purification, while ensuring the tag position (N- or C-terminal) does not interfere with protein function.

What purification methods yield the highest purity for recombinant mouse Dnajc25?

Optimal purification strategies for recombinant mouse Dnajc25 depend on the expression system and incorporated tags:

  • Affinity chromatography: For tagged proteins, this represents the primary purification step. For example, with DDK (FLAG) tagged constructs, anti-FLAG affinity columns provide high specificity . His-tagged proteins can be purified using nickel or cobalt affinity resins.

  • Size exclusion chromatography: After initial affinity purification, size exclusion chromatography effectively removes aggregates and degradation products, typically achieving >80% purity as measured by SDS-PAGE and Coomassie blue staining .

  • Ion exchange chromatography: This can serve as an intermediate purification step to separate proteins with similar molecular weights but different surface charges.

The optimal buffer conditions for maintaining protein stability during purification typically include:

  • Tris-HCl buffer (20-25 mM, pH 7.3-7.5)

  • Glycine (100 mM) to help maintain protein solubility

  • Glycerol (10%) as a stabilizing agent

For long-term storage, purified protein should be maintained at -80°C to prevent degradation, with care taken to avoid repeated freeze-thaw cycles that can compromise protein integrity .

How can researchers effectively study the interaction between mouse Dnajc25 and Hsp70 chaperones?

Investigating the functional interaction between mouse Dnajc25 and Hsp70 chaperones requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP) assays: Using epitope-tagged recombinant mouse Dnajc25 (such as Myc/DDK-tagged constructs) , researchers can perform Co-IP experiments to identify physical interactions with Hsp70 proteins in cellular contexts. This approach requires:

    • Expression of tagged Dnajc25 in appropriate cell lines

    • Lysis under non-denaturing conditions to preserve protein-protein interactions

    • Precipitation using tag-specific antibodies

    • Western blot analysis for co-precipitated Hsp70 family members

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics, SPR allows determination of association and dissociation rates between purified Dnajc25 and Hsp70 proteins. Critical parameters include:

    • Immobilization of either protein (typically the smaller one) on the sensor chip

    • Flow of the partner protein at varying concentrations

    • Analysis of binding curves to determine KD values

  • ATPase stimulation assays: Since a defining characteristic of J-domain proteins is their ability to stimulate the ATPase activity of Hsp70, researchers should measure:

    • Basal ATPase activity of purified Hsp70

    • ATPase activity in the presence of varying concentrations of Dnajc25

    • The effect of mutations in the conserved J-domain on stimulation efficiency

  • Isothermal Titration Calorimetry (ITC): This technique provides comprehensive thermodynamic parameters of binding, including:

    • Binding affinity (KD)

    • Enthalpy changes (ΔH)

    • Entropy changes (ΔS)

    • Stoichiometry of interaction

When interpreting results, researchers should consider that interactions may be transient and dependent on nucleotide state (ATP/ADP) of the Hsp70 partner.

What are the critical considerations when designing knockdown or knockout studies for mouse Dnajc25?

Designing effective knockdown or knockout studies for mouse Dnajc25 requires careful planning to ensure specificity and meaningful interpretation:

  • siRNA/shRNA design for knockdown studies:

    • Target sequence specificity is crucial to avoid off-target effects on other DnaJ family members

    • Multiple siRNA constructs targeting different regions of Dnajc25 mRNA should be tested

    • Validation of knockdown efficiency at both mRNA (qRT-PCR) and protein (Western blot) levels is essential

    • Controls should include scrambled sequences and rescue experiments with siRNA-resistant Dnajc25 constructs

  • CRISPR/Cas9 knockout strategy:

    • Guide RNA design should account for potential genomic complexity, especially if Dnajc25 forms fusion transcripts with neighboring genes (as seen with human DNAJC25-GNG10)

    • Verification of knockout should include genomic sequencing of the targeted locus

    • Potential compensatory upregulation of other DnaJ family members should be assessed

    • Phenotypic analysis should be conducted across multiple cell types or tissues due to potential tissue-specific functions

  • Conditional knockout approaches:

    • Consider tissue-specific or inducible knockout systems to circumvent potential embryonic lethality

    • Cre-loxP systems with tissue-specific promoters offer temporal and spatial control

    • Validation should include careful assessment of recombination efficiency in target tissues

  • Phenotypic analysis considerations:

    • Examine effects on protein folding and quality control pathways

    • Assess cellular stress responses, particularly under conditions of proteotoxic stress

    • Investigate potential alterations in specific client protein folding and stability

    • Evaluate possible compensatory mechanisms through transcriptomic and proteomic approaches

How should researchers design experiments to identify specific client proteins of mouse Dnajc25?

Identifying the specific client proteins of mouse Dnajc25 requires a multi-faceted experimental approach:

  • Proximity-based labeling techniques:

    • BioID or TurboID fusion constructs with Dnajc25 can identify proximal proteins in living cells

    • APEX2 fusion proteins allow temporal control of labeling through addition of biotin-phenol and H₂O₂

    • Labeled proteins can be isolated using streptavidin pulldown followed by mass spectrometry

    • Controls should include catalytically inactive fusion proteins and free enzyme expression

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Expression of epitope-tagged Dnajc25 (Myc/DDK-tagged) in relevant cell types

    • Crosslinking approaches (formaldehyde or DSP) can capture transient interactions

    • Stringent washing conditions help eliminate non-specific binding

    • Comparison of interactome under normal and stress conditions reveals context-dependent interactions

  • Chaperone trap mutants:

    • Engineering Dnajc25 variants that bind but cannot release client proteins

    • Based on analogous mutations in other DnaJ proteins that disrupt the chaperone cycle

    • These mutants can "trap" client proteins, facilitating their identification

  • In vitro binding assays with candidate proteins:

    • Purified recombinant Dnajc25 can be tested for direct binding to candidate substrates

    • Thermal shift assays to detect stabilization of client proteins in the presence of Dnajc25

    • Surface plasmon resonance to determine binding kinetics and affinities

  • Functional validation of identified clients:

    • Assess folding, stability, or activity of candidate clients in Dnajc25 knockdown or knockout models

    • Rescue experiments with wild-type vs. mutant Dnajc25 can confirm specificity

    • Co-localization studies using fluorescently tagged proteins provide spatial context for interactions

What cellular stress conditions most effectively reveal the functional importance of mouse Dnajc25?

To uncover the physiological roles of mouse Dnajc25, researchers should subject cellular models to various stress conditions that challenge protein homeostasis:

  • Heat shock response:

    • Acute heat stress (42-45°C for 15-30 minutes) followed by recovery

    • Chronic mild heat stress (39-40°C for 6-24 hours)

    • Assessment of cell viability, stress granule formation, and Hsp70 induction in wild-type vs. Dnajc25-deficient cells

  • Proteotoxic stress inducers:

    • Proteasome inhibitors (MG132, bortezomib) to impair protein degradation

    • ER stress inducers (tunicamycin, thapsigargin) to perturb protein folding

    • Oxidative stress agents (H₂O₂, paraquat) that cause protein oxidation and misfolding

    • Dosage and time-course optimization is critical for each cell type

  • Protein aggregate formation:

    • Expression of aggregation-prone proteins (polyQ proteins, α-synuclein)

    • Assessment of aggregate formation kinetics and cellular toxicity

    • Evaluation of co-localization of Dnajc25 with protein aggregates or quality control compartments

  • Comparative analysis across cell types:

    • Given the distinct expression patterns of DnaJ family members (e.g., restricted expression of Dnajc5b in testis) , different cell types may show variable dependence on Dnajc25

    • Primary cells vs. immortalized lines may reveal tissue-specific functions

    • Differentiation models can uncover developmental stage-specific requirements

Data analysis should include quantitative metrics such as:

  • Cell viability/apoptosis measurements

  • Stress response pathway activation (Western blot, qRT-PCR)

  • Protein aggregation quantification (filter trap assays, fluorescence microscopy)

  • Global proteostasis assessment (ubiquitin levels, proteasome activity)

How can researchers differentiate between direct and indirect effects in Dnajc25 functional studies?

Distinguishing direct from indirect effects in Dnajc25 functional studies requires rigorous experimental design and careful controls:

  • Structure-function relationship analysis:

    • Generate a panel of Dnajc25 mutants targeting specific domains:

      • J-domain mutations (particularly the HPD motif) to disrupt Hsp70 interaction

      • Substrate-binding domain mutations to affect client recognition

      • Mutations in regions with high conservation across species (98% identity with human ortholog)

    • Complementation assays with these mutants in Dnajc25-deficient cells can identify which functions require direct interaction

  • Acute vs. chronic depletion comparisons:

    • Inducible knockdown or knockout systems allow temporal control

    • Acute effects (24-48 hours post-induction) are more likely to represent direct consequences

    • Chronic effects (days to weeks) may involve compensatory mechanisms and secondary adaptations

    • Transcriptomic analysis at multiple time points can track the evolution of cellular responses

  • In vitro reconstitution approaches:

    • Purified recombinant components can be used to reconstitute chaperone activities

    • Direct effects should be reproducible in simplified systems with defined components

    • Comparison with cellular outcomes helps distinguish direct from context-dependent effects

  • Proximity-based approaches:

    • FRET or BRET biosensors incorporating Dnajc25 and potential clients/partners

    • Split fluorescent protein complementation assays

    • These techniques provide spatial and temporal resolution of direct interactions in living cells

  • Quantitative data analysis frameworks:

    • Network analysis of proteomics or transcriptomics data to identify direct nodes vs. downstream effectors

    • Bayesian causal network modeling to infer direct regulatory relationships

    • Comparison across multiple perturbation types (knockdown, overexpression, mutation) to triangulate direct effects

What are the best practices for comparing mouse Dnajc25 function with its human ortholog in translational research?

Translating findings between mouse Dnajc25 and human DNAJC25 requires systematic approaches to account for species-specific differences despite their high sequence conservation (98%) :

  • Sequence and structure comparative analysis:

    • Detailed alignment of mouse and human proteins to identify conserved vs. divergent residues

    • Homology modeling based on known structures of related DnaJ proteins

    • Conservation assessment across multiple species to identify functionally constrained regions

    • Special attention to potential regulatory sites (post-translational modifications, localization signals)

  • Cross-species complementation studies:

    • Expression of human DNAJC25 in mouse Dnajc25-knockout cells and vice versa

    • Quantitative assessment of functional rescue across multiple phenotypic readouts

    • Competition assays between species orthologs can reveal subtle functional differences

  • Parallel experimental systems:

    • Matched cell types from both species (e.g., primary fibroblasts, pluripotent stem cells)

    • Isogenic backgrounds through genome editing to introduce equivalent mutations

    • Consistent stress conditions and experimental parameters across species

    • Direct comparison of interactomes in human vs. mouse cellular contexts

  • Consideration of genomic context differences:

    • Human DNAJC25 has been documented to form fusion transcripts with the neighboring GNG10 gene

    • Assessment of whether similar genomic arrangements and transcript variants exist in mice

    • Analysis of species-specific regulatory elements that may affect expression patterns

    • Examination of potential differences in nonsense-mediated decay sensitivity

  • Biomarker and therapeutic target validation:

    • Validation of discovered phenotypes in patient-derived samples

    • Assessment of expression changes in relevant human disease tissues

    • Correlation of genetic variants with disease phenotypes in human populations

    • Therapeutic approaches should be validated in human cellular models before clinical translation

ParameterHuman DNAJC25Mouse Dnajc25Implications for Translation
Sequence identityReference98% identity High functional conservation expected
Genomic arrangementForms fusion transcripts with GNG10 Requires investigationMay affect functional studies and targeting strategies
Expression patternVarious tissuesRequires systematic profilingMay affect relevance of tissue-specific findings
Disease associationsLimited data availableModel systems neededTranslational potential requires human disease validation

How can researchers overcome challenges in generating high-quality antibodies against mouse Dnajc25?

Developing specific and sensitive antibodies against mouse Dnajc25 presents several challenges that can be addressed through strategic approaches:

  • Antigen design considerations:

    • Select unique epitopes with minimal homology to other DnaJ family members

    • Consider using recombinant fragments rather than full-length protein

    • Human DNAJC25 control fragments (aa 271-360) provide a template for designing mouse-specific antigens

    • In silico epitope prediction tools can identify regions with high antigenicity and surface exposure

  • Validation strategy for antibody specificity:

    • Essential controls include Dnajc25 knockout/knockdown samples

    • Blocking experiments using recombinant protein fragments (100x molar excess recommended)

    • Pre-incubation of antibody-protein control fragment mixture (30 min at room temperature)

    • Cross-reactivity testing against related DnaJ family members

  • Application-specific optimization:

    • For Western blot: Determine optimal detergent conditions for extraction

    • For IHC/ICC: Test multiple fixation methods (PFA vs. methanol)

    • For IP applications: Evaluate different lysis buffers to preserve epitope accessibility

    • For flow cytometry: Consider carrier proteins to reduce non-specific binding

  • Custom antibody development approaches:

    • Monoclonal antibody development through hybridoma technology offers high specificity

    • Recombinant antibody technologies (phage display, yeast display) provide renewable reagents

    • Multi-epitope targeting strategy with antibody cocktails improves detection reliability

    • Consider species cross-reactivity needs early in design (e.g., whether human/mouse cross-reactivity is desired)

What are the critical parameters for reproducible functional assays with recombinant mouse Dnajc25?

Ensuring reproducibility in functional assays with recombinant mouse Dnajc25 requires careful attention to several critical parameters:

  • Protein quality control metrics:

    • Purity assessment by SDS-PAGE (target >80% as established for similar proteins)

    • Verification of correct folding through circular dichroism or limited proteolysis

    • Batch-to-batch consistency validation through activity assays

    • Monitoring of aggregation state via dynamic light scattering

  • Storage and handling considerations:

    • Optimal buffer composition (25 mM Tris-HCl, pH 7.3, 100 mM glycine, 10% glycerol)

    • Aliquoting to avoid repeated freeze-thaw cycles

    • Temperature sensitivity assessment (-80°C storage recommended)

    • Concentration determination using standardized methods (BCA preferred over spectrophotometric methods)

  • Functional assay standardization:

    • Establishing positive controls with well-characterized DnaJ proteins

    • Determining linear range of activity for quantitative comparisons

    • Inclusion of reference standards across experiments

    • Normalization methods for inter-laboratory comparisons

  • Co-factor and reaction condition optimization:

    • ATP concentration and nucleotide exchange rates for Hsp70 stimulation assays

    • Divalent cation (Mg²⁺, Mn²⁺) concentration optimization

    • pH and ionic strength effects on activity

    • Temperature dependence characterization, particularly for heat-sensitive assays

Detailed protocols should specify all critical parameters, including:

  • Protein concentration ranges (working concentration >50 μg/mL recommended)

  • Buffer composition and pH

  • Temperature and incubation times

  • Order of component addition

  • Detection methods and instrumentation settings

How might single-cell approaches advance our understanding of mouse Dnajc25 function?

Single-cell technologies offer unprecedented opportunities to uncover cell-specific functions and heterogeneous responses involving mouse Dnajc25:

  • Single-cell transcriptomics applications:

    • Profiling Dnajc25 expression across diverse cell populations within tissues

    • Identifying co-expression patterns with other chaperone network components

    • Characterizing cell state-dependent regulation during development or stress responses

    • Detecting rare cell populations with unique Dnajc25 dependency

  • Single-cell proteomics approaches:

    • Quantifying Dnajc25 protein levels and post-translational modifications at single-cell resolution

    • Correlating Dnajc25 abundance with client protein stability

    • Mapping proteomic signatures of Dnajc25 deficiency across heterogeneous populations

    • Computational integration with transcriptomic data to identify post-transcriptional regulation

  • Spatial transcriptomics/proteomics integration:

    • Mapping Dnajc25 expression in the tissue microenvironmental context

    • Correlating spatial distribution with tissue architecture and specialized functions

    • Identifying niche-dependent regulation of chaperone networks

    • Visualizing stress response propagation across neighboring cells

  • Live-cell imaging at single-cell resolution:

    • CRISPR-based endogenous tagging of Dnajc25 for physiological expression monitoring

    • Tracking dynamic relocalization during stress responses

    • Measuring protein-protein interaction kinetics using fluorescence correlation spectroscopy

    • Quantifying stochastic variation in chaperone activity across isogenic populations

These approaches can address fundamental questions including:

  • Does Dnajc25 function vary across cell types despite ubiquitous expression?

  • How does single-cell heterogeneity in Dnajc25 levels affect cellular resilience to stress?

  • Are there cell state-specific client interactions that conventional bulk approaches miss?

  • How does the spatial organization of Dnajc25 within cells contribute to compartment-specific proteostasis?

What emerging CRISPR-based technologies will enhance the study of mouse Dnajc25 function?

Advanced CRISPR-based technologies offer powerful new approaches to dissect mouse Dnajc25 function with unprecedented precision:

  • CRISPRi/CRISPRa for tunable expression modulation:

    • dCas9-KRAB repressors for titratable knockdown without genomic editing

    • dCas9-VP64 or dCas9-p300 activators for controlled overexpression

    • Multiplexed CRISPRi targeting of Dnajc25 alongside related chaperones to dissect redundancy

    • Temporal control through inducible systems to distinguish acute from adaptive responses

  • Base and prime editing for precise genetic manipulation:

    • Introduction of specific point mutations to dissect structure-function relationships

    • Targeted conversion of critical residues without double-strand breaks

    • Engineering tagged versions at endogenous loci without disrupting genomic context

    • Creating humanized mouse Dnajc25 variants to test species-specific functions

  • CRISPR screening approaches:

    • Genome-wide synthetic lethality screens in Dnajc25-deficient backgrounds

    • Domain-focused saturating mutagenesis to map functional regions

    • Dual-gene knockout screens to identify genetic interactions

    • Single-cell CRISPR screens with transcriptomic readouts to capture complex phenotypes

  • Spatiotemporal control of Dnajc25 function:

    • Optogenetic or chemically inducible degradation systems for acute protein depletion

    • Tissue-specific or cell type-specific Cas9 expression for in vivo functional studies

    • Subcellular targeting of CRISPR effectors to manipulate Dnajc25 in specific compartments

    • CRISPR-based lineage tracing to follow long-term consequences of Dnajc25 perturbation

  • In vivo applications:

    • Somatic genome editing in adult mice for tissue-specific knockout

    • Non-invasive delivery systems using AAV or lipid nanoparticles

    • CRISPR knock-in reporter lines for real-time monitoring of Dnajc25 expression

    • Genetic interaction testing in complex tissue environments

These technologies will enable researchers to address sophisticated questions such as:

  • What is the minimal functional domain structure required for specific Dnajc25 activities?

  • How does Dnajc25 function in the context of the complete chaperone network?

  • What cell types and developmental stages show particular sensitivity to Dnajc25 perturbation?

  • How do specific client interactions vary across physiological and pathological conditions?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.