Recombinant Mouse DnaJ homolog subfamily C member 4 (Dnajc4)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Dnajc4 (UniProt ID: Q9D844) belongs to the Hsp40 protein family, which assists Hsp70 chaperones in ATP-dependent substrate binding and folding. Recombinant Dnajc4 is engineered with an N-terminal His tag for purification and detection. Key production details include:

CharacteristicSpecification
Expression HostE. coli
TagN-terminal His tag
Protein LengthFull-length (1–244 amino acids)
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C (avoid freeze-thaw cycles)

The protein is lyophilized and reconstituted in sterile water to concentrations of 0.1–1.0 mg/mL, often with 50% glycerol for stability .

Research Applications and Functions

Roles in Cellular Processes
Dnajc4 is implicated in:

  1. Protein Quality Control: Assists Hsp70 in folding nascent or misfolded proteins in mitochondria .

  2. Stress Response: Upregulated under oxidative, thermal, or chemical stress .

  3. Disease Association: Linked to intellectual disability, leukocyte adhesion defects, and multiple endocrine neoplasia type 1 (MEN1) .

Experimental Uses

ApplicationMethod
Protein InteractionCo-IP, pull-down assays to study Hsp70/Dnajc4 complexes .
QuantificationELISA kits (e.g., Abbexa) for detecting endogenous or recombinant Dnajc4
Structural StudiesX-ray crystallography or NMR to map substrate-binding sites .

Chemical and Environmental Interactions

Dnajc4 expression is modulated by environmental toxins and endocrine disruptors:

ChemicalEffect on Dnajc4MechanismSource
Bisphenol A↓ mRNA expressionEpigenetic methylation changes
Ochratoxin A↑ mRNA expressionPromoter acetylation
Benzo[a]pyrene↑ mRNA expressionAryl hydrocarbon receptor activation
Chlorpyrifos↑ mRNA expressionOxidative stress induction

Interactions and Pathways

Protein Partners
Dnajc4 interacts with:

  • Hsp70: Directly binds to regulate ATPase activity .

  • Mitochondrial Proteins: Associates with inner membrane or matrix proteins .

Pathways
While specific pathways are not fully mapped in the provided sources, Dnajc4 is inferred to participate in:

  • Proteostasis Network: Coordinates with Hsp70 and Hsp90 to maintain protein homeostasis.

  • Stress Response Signaling: Modulates cellular adaptation to environmental insults .

Recombinant Protein Advantages

FeatureAdvantage
His-TagFacilitates affinity purification and Western blot detection .
Full-Length SequencePreserves native conformation for structural studies .
High PurityMinimizes background noise in biochemical assays .

Limitations and Considerations

  • Sequence Variability: Recombinant Dnajc4 may differ from endogenous forms in post-translational modifications .

  • Reconstitution: Requires careful handling to avoid aggregation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Dnajc4; Mcg18; DnaJ homolog subfamily C member 4; Multiple endocrine neoplasia type 1 candidate protein number 18 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Dnajc4
Target Protein Sequence
MPSLLLQLPLRLCRLWPHSLSIRLLTAATGQRSVPTNYYELLGVHPGASAEEIKRAFFTK SKELHPDRDPGNPALHSRFVELNEAYRVLSREESRRNYDHQLHSASPPKSSGSTAEPKYT QQTHSSWEPPNAQYWAQFHSVRPQGPESRKQQRKHNQRVLGYCLLLMVAGMGLHYVAFRK LEQVHRSFMDEKDRIITAIYNDTRARARANRARIQQERQQRQQPRAEPSLPPESSRIMPQ DTSP
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Dnajc4 and what is its function in cellular biology?

Dnajc4, also known as DnaJ heat shock protein family (Hsp40) member C4, belongs to the highly conserved DNAJ/HSP40 family of molecular chaperones. This protein contains the characteristic J-domain that regulates the function of HSP70 chaperones . Like other DNAJ family members, Dnajc4 likely participates in protein folding, transport, and degradation pathways.

The protein is encoded by the Dnajc4 gene located on chromosome 11 in both humans and mice . Several synonyms exist for this protein, including HSPF2, MCG18, DANJC4, and multiple MGC designations (MGC19482, MGC57189, MGC71863) . The protein functions primarily as a co-chaperone that stimulates the ATPase activity of HSP70s, facilitating proper protein folding and cellular stress responses.

How is Dnajc4 expression regulated in different tissues and under various conditions?

Dnajc4 expression appears to be differentially regulated across tissues and in response to various environmental stimuli and chemical compounds. According to gene-chemical interaction data, several compounds affect Dnajc4 expression:

Table 1: Chemical compounds affecting Dnajc4 expression

CompoundEffect on ExpressionEvidence TypeReference
1,2-dimethylhydrazineDecreasesISOPMID:22206623
17beta-estradiolDecreasesISOPMID:39298647
2,3,7,8-tetrachlorodibenzodioxineIncreasesEXPPMID:33387578
6-propyl-2-thiouracilDecreasesEXPPMID:30047161
all-trans-retinoic acidIncreases--

Additionally, tissue-specific expression patterns have been documented, though complete expression profiles across all tissues are still being investigated .

What are the known protein interaction partners of Dnajc4?

While the search results don't provide a comprehensive list of Dnajc4-specific interaction partners, as a DNAJ family member, it likely interacts with HSP70 chaperones as its primary functional partners.

For researchers interested in identifying Dnajc4 interaction partners, techniques such as co-immunoprecipitation, yeast two-hybrid screening, and proximity-dependent biotin identification (BioID) would be appropriate methodological approaches. The cellular context should be carefully considered when designing such experiments, as interaction partners may vary by cell type and physiological condition.

What are the most effective methods for expressing and purifying recombinant mouse Dnajc4?

Based on available data, recombinant mouse Dnajc4 can be produced in several expression systems:

Table 2: Expression systems for recombinant Dnajc4 production

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effectiveMay lack post-translational modifications
Mammalian cells (HEK293)Proper folding, post-translational modificationsLower yield, higher cost
In vitro cell-free systemRapid production, avoids toxicity issuesPotentially lower yield
Wheat germAlternative for proteins toxic to other systemsSpecialized equipment required

For purification, His-tag, GST-tag, Avi-tag, and Fc-tag fusion strategies have been documented . A typical purification protocol would involve:

  • Expression in the chosen system (E. coli BL21(DE3) is commonly used)

  • Cell lysis under native conditions

  • Affinity chromatography (Ni-NTA for His-tagged protein)

  • Buffer exchange and concentration

  • Quality control by SDS-PAGE and Western blotting

When designing expression constructs, researchers should consider that the J-domain functionality is critical, so ensuring this domain remains properly folded is essential for functional studies.

How can I accurately detect and quantify mouse Dnajc4 protein in biological samples?

Several methods are available for detecting Dnajc4 in mouse samples:

  • ELISA: Commercial mouse Dnajc4 ELISA kits are available with detection ranges of approximately 0.156-10 ng/ml. These sandwich enzyme-linked immunosorbent assays utilize specific antibodies and HRP-conjugated detection systems with TMB substrate .

  • Western blotting: Using specific antibodies against Dnajc4, though researchers should validate antibody specificity.

  • Immunofluorescence/Immunocytochemistry: Fluorescently-labeled antibodies can detect cellular localization of Dnajc4. While specific protocols for Dnajc4 are not provided in the search results, protocols similar to those used for other DNAJ family members like DNAJA1 could be adapted .

  • RT-qPCR: For mRNA expression analysis, though this measures transcript rather than protein levels.

When designing detection experiments, appropriate controls should include:

  • Positive control (recombinant Dnajc4 protein)

  • Negative control (samples from knockdown/knockout models)

  • Loading controls for Western blots (β-actin, GAPDH)

  • Isotype controls for immunofluorescence

What considerations should be made when designing Dnajc4 knockout or knockdown studies?

When designing Dnajc4 genetic manipulation studies, researchers should consider:

  • Complete knockout vs. conditional knockout: Given the potential importance of Dnajc4 in cellular function, conditional knockouts may be preferable to avoid developmental lethality.

  • Compensation by other DNAJ family members: Due to functional redundancy within the DNAJ family, researchers should monitor expression changes in related family members (particularly other DNAJC subfamily proteins).

  • Tissue specificity: Consider using tissue-specific promoters for Cre-loxP systems if investigating tissue-specific functions.

  • Knockdown alternatives: siRNA or shRNA approaches may be preferable for initial studies before committing to knockout models.

  • Validation strategies: Multiple validation methods should be employed:

    • Genomic PCR to confirm genetic modification

    • RT-qPCR to verify reduced mRNA expression

    • Western blotting to confirm protein reduction

    • Functional assays to assess physiological impact

  • Phenotypic analysis: Comprehensive phenotyping should include assessment of stress responses, protein folding capacity, and tissue-specific functional tests.

What is the potential role of Dnajc4 in neurodegeneration, and how can this be studied?

While the search results don't specifically highlight Dnajc4's role in neurodegeneration, DNAJ family proteins have been implicated in various neurodegenerative disorders . To study Dnajc4's potential role:

  • Expression analysis: Compare Dnajc4 expression in healthy vs. neurodegenerative disease models or patient samples.

  • Protein aggregation studies: Examine whether Dnajc4 co-localizes with protein aggregates (e.g., amyloid-β, tau, α-synuclein) in disease models.

  • Chaperone activity assays: Assess whether Dnajc4 can modulate the aggregation of disease-related proteins in vitro.

  • Genetic interaction studies: Investigate whether Dnajc4 overexpression or knockdown modifies the phenotype in neurodegenerative disease models.

  • Stress response evaluation: Examine how Dnajc4 expression changes under stresses relevant to neurodegeneration (oxidative stress, ER stress, etc.).

A methodological approach would involve combining cellular models (primary neurons, neuronal cell lines) with animal models (transgenic mice) and potentially human patient samples for translational relevance.

How does Dnajc4 correlate with other genes in expression studies, and what biological pathways might this implicate?

According to correlation data, Dnajc4 expression shows both positive and negative correlations with various genes :

Table 3: Top positively correlated genes with Dnajc4

GeneCorrelation coefficient (r)
ier2b0.054
eef1da0.052
cd9b0.049
epcam0.049
capns1a0.047

Table 4: Top negatively correlated genes with Dnajc4

GeneCorrelation coefficient (r)
marcksb-0.028
nucks1a-0.024
si:ch211-288g17.3-0.024
top1l-0.024
seta-0.023

These correlations suggest potential functional relationships with genes involved in:

  • Cellular stress response (ier2b)

  • Protein synthesis (eef1da)

  • Cell adhesion and membrane organization (cd9b, epcam)

  • Calcium-dependent proteolysis (capns1a)

The negative correlations with genes involved in DNA metabolism and cell cycle regulation (top1l, nucks1a) may indicate inverse relationships with these processes.

To further explore these connections, researchers could conduct pathway enrichment analysis, protein-protein interaction network analysis, and functional validation experiments.

Could Dnajc4 be a potential therapeutic target or immunization candidate, similar to other heat shock proteins?

Some heat shock proteins have shown potential as therapeutic targets or immunization candidates. For example, DnaJ (Hsp40) has demonstrated immunogenicity and protective efficacy against Streptococcus pneumoniae infection in mouse models .

To evaluate Dnajc4's potential:

  • Immunogenicity assessment: Determine if recombinant Dnajc4 elicits immune responses, including:

    • Antibody production (titer and isotype analysis)

    • T-cell responses (proliferation assays, cytokine production)

  • Protective efficacy studies: Challenge immunized animals with relevant disease models to assess protection.

  • Mechanism exploration: Investigate whether protection is mediated by:

    • Antibody-dependent mechanisms

    • Cell-mediated immunity

    • Molecular mimicry or cross-reactivity

  • Safety evaluation: Assess potential autoimmune responses due to homology with host proteins.

For therapeutic targeting approaches, researchers could explore:

  • Small molecule modulators of Dnajc4 activity

  • Peptide inhibitors of specific Dnajc4 interactions

  • Gene therapy approaches to modulate Dnajc4 expression

How can I address solubility issues when working with recombinant Dnajc4 protein?

Chaperone proteins like Dnajc4 can present solubility challenges during recombinant expression. To address these issues:

  • Optimization of expression conditions:

    • Lower induction temperature (16-20°C)

    • Reduced IPTG concentration for induction

    • Shorter induction time

    • Co-expression with chaperones

  • Buffer optimization:

    • Include stabilizing agents (glycerol, arginine, trehalose)

    • Test different pH conditions

    • Evaluate various salt concentrations

    • Consider mild detergents for membrane-associated forms

  • Protein engineering approaches:

    • Express functional domains separately

    • Use solubility-enhancing fusion partners (SUMO, MBP, TRX)

    • Consider surface residue mutations to enhance solubility

  • Refolding strategies (if inclusion bodies form):

    • Gradual dialysis methods

    • On-column refolding

    • Pulse refolding techniques

Each approach requires systematic optimization for the specific construct being used.

How should I interpret contradictory data regarding Dnajc4 expression in different experimental conditions?

When facing contradictory Dnajc4 expression data across different studies or conditions:

  • Evaluate methodological differences:

    • Detection method sensitivity and specificity

    • Sample preparation variations

    • Antibody clone differences for protein detection

    • Primer design differences for mRNA detection

  • Consider biological variables:

    • Tissue/cell type differences

    • Age and sex of experimental animals

    • Genetic background variations

    • Environmental conditions and stressors

  • Temporal dynamics:

    • Acute vs. chronic exposure to stimuli

    • Time points of analysis

    • Circadian influences

  • Validation approach:

    • Use multiple detection methods in parallel

    • Include appropriate positive and negative controls

    • Perform dose-response or time-course studies

    • Consider single-cell analyses to detect heterogeneity

For example, the contradictory effects of tetrachlorodibenzodioxine on Dnajc4 expression reported in different studies may be explained by differences in exposure duration, concentration, or the specific model system used.

What are the best experimental controls when studying Dnajc4 function in cellular stress response pathways?

To robustly assess Dnajc4 function in stress response:

  • Positive controls:

    • Known stress inducers (heat shock, oxidative stress inducers, ER stress agents)

    • Well-characterized heat shock proteins (HSP70, HSP90)

    • Validated stress response markers (phospho-eIF2α, ATF4, XBP1 splicing)

  • Negative controls:

    • Untreated/unstressed cells

    • Non-functional Dnajc4 mutants (J-domain mutations)

    • Unrelated proteins of similar size/structure

  • Experimental validation controls:

    • Multiple stress intensities and durations

    • Recovery time course after stress

    • Multiple cell types or tissues

    • Complementary in vitro and in vivo approaches

  • Technical controls:

    • Dose-dependent effects of Dnajc4 modulation

    • Multiple independent clones/lines

    • Multiple siRNAs targeting different regions of Dnajc4 mRNA

    • Rescue experiments with wild-type Dnajc4

To conclusively link Dnajc4 to specific stress responses, combination approaches using gain-of-function and loss-of-function models are recommended.

What emerging technologies could advance our understanding of Dnajc4 function?

Several cutting-edge technologies could significantly enhance Dnajc4 research:

  • CRISPR-Cas9 genome editing:

    • Generation of precise Dnajc4 variants with modified domains

    • Endogenous tagging for visualizing native protein

    • CRISPRa/CRISPRi for temporal control of expression

  • Cryo-electron microscopy:

    • Structural determination of Dnajc4 alone and in complexes

    • Visualization of dynamic conformational changes during chaperone cycles

  • Proximity labeling proteomics (BioID, APEX):

    • Comprehensive identification of Dnajc4 interactors in different cellular compartments

    • Temporal mapping of interaction networks during stress responses

  • Single-cell technologies:

    • scRNA-seq to identify cell populations dependent on Dnajc4

    • Spatial transcriptomics to map Dnajc4 expression in complex tissues

  • Protein folding sensors and reporters:

    • Real-time monitoring of Dnajc4 chaperone activity

    • Client protein folding status visualization

These approaches could help resolve currently unanswered questions about Dnajc4's specific clients, spatial and temporal activity patterns, and functional redundancy with other DnaJ proteins.

How might Dnajc4 research contribute to understanding broader cellular processes like inflammation and protein quality control?

Dnajc4 research could provide insights into several important cellular processes:

  • Inflammation regulation:

    • While Dnajc4 itself hasn't been directly linked to inflammation in the search results, the related protein FNDC4 shows anti-inflammatory effects on macrophages

    • Investigation of Dnajc4's potential role in immune cell function could reveal parallel mechanisms

  • Protein quality control systems:

    • As part of the DNAJ/HSP70 chaperone network, Dnajc4 likely contributes to proteostasis

    • Understanding its specific clients could reveal vulnerable proteins in disease states

  • Cellular stress responses:

    • Mapping Dnajc4's role in responding to various stressors could identify critical cell survival pathways

    • Integration with other stress response systems (unfolded protein response, integrated stress response)

  • Disease mechanisms:

    • Other DNAJ proteins are implicated in neurodegeneration

    • Investigating whether Dnajc4 has similar neuroprotective functions could reveal therapeutic targets

Methodologically, integrative approaches combining proteomics, transcriptomics, and functional assays across relevant disease models would be most informative.

What experimental approaches would be most valuable for translating basic Dnajc4 research findings to clinical applications?

To bridge basic Dnajc4 research with potential clinical applications:

  • Patient-derived models:

    • iPSC-derived cell types from relevant disease patients

    • Organoids modeling disease-affected tissues

    • Humanized mouse models

  • High-throughput screening:

    • Small molecule screens for Dnajc4 activity modulators

    • CRISPR screens to identify synthetic lethal interactions

    • Phenotypic screens in disease models

  • Biomarker development:

    • Evaluate Dnajc4 expression or PTMs as disease biomarkers

    • Develop assays to measure Dnajc4 activity in patient samples

    • Identify client protein folding status as surrogate markers

  • Therapeutic proof-of-concept studies:

    • Gene therapy approaches to modulate Dnajc4 expression

    • Protein replacement or supplementation strategies

    • Peptide-based approaches targeting specific interactions

  • Translational validation:

    • Multi-species validation of findings (mouse, rat, non-human primates)

    • Ex vivo testing in patient-derived samples

    • Retrospective analysis using biobanked specimens

These approaches should prioritize disease contexts where chaperone dysfunction has been implicated, such as neurodegenerative disorders, inflammatory conditions, and certain cancers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.