Recombinant Mouse Dolichol-phosphate mannosyltransferase subunit 3 (Dpm3)
Shipped with Ice Packs 
In Stock 
Description
Production and Purification Methods
Recombinant mouse Dpm3 is produced in heterologous systems for research and therapeutic applications.
Expression Systems and Tags
| System | Tag/Conjugate | Purity (%) | Molecular Weight (kDa) | Source |
|---|---|---|---|---|
| E. coli | His-tag | >95 | 11.3 (with tag) | |
| Insect Cells | rho-1D4 tag | N/A | 11.3 (with tag) | |
| Mammalian Cells | None (Native) | N/A | ~9.2 |
Key Production Steps:
-
Cloning: Mouse Dpm3 cDNA is inserted into expression vectors (e.g., pET or pcDNA).
-
Fermentation: E. coli cultures are induced with IPTG; insect cells use baculovirus systems.
-
Purification: Affinity chromatography (His-tag) or ion-exchange chromatography .
Research Applications
Recombinant Dpm3 is critical for studying glycosylation disorders and GPI anchor deficiencies.
Functional Studies
Clinical Relevance
-
Congenital Disorders: Mutations in DPM3 are linked to congenital disorder of glycosylation type I O (CDG1O), characterized by impaired N-glycosylation and neurological defects .
-
Therapeutic Targeting: Recombinant Dpm3 may aid in correcting glycosylation defects in cell models .
Subunit Interactions
Mutational Analysis
| Mutation | Effect | Source |
|---|---|---|
| Dpm3dC (Δ27 C-term) | Loss of Dpm1 binding; impaired DPM synthase activity | |
| Dpm2FY/LS (Phe21/Tyr23 → Leu/Ser) | Disrupted Dpm3-Dpm2 interaction; reduced DPM synthase activity |
Table 1: Subunit-Specific Roles in DPM Synthase Activity
Table 2: Recombinant Dpm3 Applications in Research
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional charges will apply.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Dpm3; Dolichol-phosphate mannosyltransferase subunit 3; Dolichol-phosphate mannose synthase subunit 3; DPM synthase subunit 3; Dolichyl-phosphate beta-D-mannosyltransferase subunit 3; Mannose-P-dolichol synthase subunit 3; MPD synthase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-92
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Dpm3
Target Protein Sequence
MTKLTQWLWGLALLGSAWAALTMGALGLELPFPCREVLWPLPAYLLVSAGCYALGTVGYR
VATFHDCEDAARELQSQIVEARADLARRGLRF
Uniprot No.
Target Background
Function
Dpm3 is a stabilizer subunit of the dolichol-phosphate mannose (DPM) synthase complex. It plays a crucial role in tethering the catalytic subunit DPM1 to the endoplasmic reticulum.
Database Links
Protein Families
DPM3 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
