Recombinant Mouse Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (Rpn2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Rpn2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit; Ribophorin II; RPN-II; Ribophorin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-631
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
LTPTHYLTKQDVERLKASLDRPFTDLESAFYSIVGLSSLGVQVPDVKKACTFIKSNLDPS NVDSLFYAAQSSQVLSGCEISVSNETKELLLAAVSEDSPIAQIYHAVAALSGFGLPLASN EALGALTARLGKEETVLATVQALQTASHLSQQADLRNIVEEIEDLVARLDELGGVYLQFE EGLELTALFVAATYKLMDHVGTEPSMKEDQVIQLMNTIFSKKNFESLSEAFSVASAAAAL SQNRYHVPVVVVPEGSTSDTQEQAILRLQVSNVLSQPLAQAAVKLEHAKSAATRATVLQK TPFSLVGNVFELNFKNVKLSSGYYDFSVRVEGDSRYIANTVELRVKISTEVGITNVDLST VDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQK TGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVV IKFPEEEAPSTVLSQSLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIR IGANVSNFTFAPSTVIFHLGHAAMLGLMYIYWTQLNMFQTLKYLAVLGTVTFLAGNRMLA QHAVKRTAH
Uniprot No.

Target Background

Function
Recombinant Mouse Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (Rpn2) is a subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the first step in protein N-glycosylation. N-glycosylation is a co-translational process, and the OST complex associates with the Sec61 complex at the translocon, mediating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for optimal enzyme activity.
Gene References Into Functions
  1. S-glutathionylation of Rpn2 contributes to H2O2-induced inhibition of 26S proteasomal function. PMID: 19549781
Database Links
Protein Families
SWP1 family
Subcellular Location
Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of mouse Rpn2 protein?

Rpn2 is a highly conserved type I integral membrane glycoprotein found exclusively in the rough endoplasmic reticulum (ER). The mouse Rpn2 protein consists of 631 amino acid residues with a molecular weight of approximately 69 kDa . The protein contains multiple domains that facilitate its integration into the ER membrane and interaction with other components of the oligosaccharyltransferase (OST) complex. Its structural organization is critical for maintaining the unique architecture of the rough ER and facilitating proper protein glycosylation processes .

What are the primary functions of Rpn2 in cellular physiology?

Rpn2 serves as an essential subunit of the N-oligosaccharyltransferase (OST) complex that conjugates high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains . This N-linked glycosylation is critical for proper protein folding, quality control, and trafficking of transmembrane glycoproteins . Additionally, Rpn2 plays a significant role in the translocation of secretory proteins and maintenance of rough ER structural integrity . Research has demonstrated that Rpn2 regulates the glycosylation of multiple proteins, including growth factor receptors and drug transporters, thereby influencing various cellular processes including proliferation, differentiation, and drug resistance mechanisms .

What are the most effective methods for detecting and quantifying Rpn2 expression?

For detection and quantification of Rpn2 at the mRNA level, quantitative real-time PCR (qRT-PCR) provides a reliable approach. Researchers have successfully used primers targeting specific regions of the Rpn2 gene, with GAPDH often serving as an internal control for normalization . The primer sequences that have shown good results include:

  • Forward primer: 5′-TGCCGAGCCAGACAACAAGAA-3′

  • Reverse primer: 5′-AGTAGAGAGTGTAGGTGCCAGAGG-3′

For protein-level detection, Western blotting with specific anti-Rpn2 antibodies is the standard approach. When performing immunohistochemical analysis, optimal results have been achieved using paraffin-embedded sections (4 μm) subjected to antigen retrieval with 10 nM citrate buffer (pH 6.0), followed by incubation with primary antibody against Rpn2 (1:100 dilution) . For visualization in cellular contexts, immunofluorescence microscopy with membrane co-staining (using lipophilic dyes like DiI) can effectively demonstrate Rpn2's localization patterns and any alterations resulting from experimental manipulations .

What approaches are most effective for modulating Rpn2 expression in experimental systems?

RNA interference has proven highly effective for Rpn2 knockdown studies. Both siRNA and shRNA approaches have been successfully implemented across multiple cell types to reduce Rpn2 expression . When transfecting cells with Rpn2-specific siRNA, Lipofectamine 3000 reagent has shown good efficiency with validation of knockdown typically performed 48 hours post-transfection through both qRT-PCR and Western blotting .

For rescue experiments, reintroduction of Rpn2 following knockdown has been accomplished through expression vectors containing the Rpn2 coding sequence. This approach is particularly valuable for confirming the specificity of observed phenotypes and for structure-function studies using modified Rpn2 variants .

It's important to note that complete Rpn2 knockout may be lethal in many cell types due to its essential role in protein glycosylation. Therefore, inducible or partial knockdown systems often provide more experimentally tractable approaches for studying Rpn2 function in cellular contexts.

How does Rpn2 facilitate N-linked glycosylation of target proteins?

Rpn2 functions as a crucial component of the oligosaccharyltransferase (OST) complex that catalyzes the transfer of high-mannose oligosaccharides to asparagine residues within the N-X-S/T consensus motif of nascent polypeptide chains . The protein specifically contributes to the recognition and positioning of substrate proteins within the OST complex, facilitating efficient glycosylation.

Experimental evidence indicates that Rpn2 silencing significantly reduces the glycosylation status of multiple target proteins. For instance, in colorectal cancer cells, RPN2 knockdown decreased the molecular weight of EGFR compared to control conditions, with further decrease observed following PNGase F treatment—confirming that the change in molecular weight was indeed due to altered glycosylation rather than protein degradation . This suggests that Rpn2 is essential for the proper N-glycan transfer to specific substrate proteins during their synthesis and processing in the ER.

What experimental approaches can demonstrate Rpn2's impact on protein glycosylation?

Several complementary experimental approaches can effectively demonstrate Rpn2's impact on protein glycosylation:

  • Molecular weight shift analysis: Western blotting of Rpn2-modulated cells can reveal molecular weight shifts in glycoprotein targets. Treatment with PNGase F (which removes N-glycan chains) provides confirmation that observed changes are specifically due to alterations in N-linked glycosylation .

  • Glycosylation inhibitor comparisons: Parallel experiments with known N-linked glycosylation inhibitors (such as tunicamycin) can help validate Rpn2-specific effects. Studies have shown that tunicamycin treatment produces similar effects to RPN2 knockdown on EGFR glycosylation status .

  • Subcellular localization analysis: Immunofluorescence microscopy can reveal changes in cellular localization of glycoproteins following Rpn2 modulation. For example, in cells with normal Rpn2 expression, EGFR predominantly localizes to the plasma membrane, while in Rpn2-silenced cells, EGFR is found primarily in intracellular compartments .

  • Proteasomal degradation assessment: Co-treatment with proteasome inhibitors (such as MG-132) can help distinguish between glycosylation defects and protein stability issues. Increased expression of target proteins in Rpn2-knockdown cells following MG-132 treatment suggests that improper glycosylation leads to enhanced proteasomal degradation .

How does Rpn2 influence cancer cell behavior through glycosylation mechanisms?

Rpn2 exerts significant effects on cancer cell behavior through its glycosylation of key signaling proteins. In colorectal cancer cells, RPN2 silencing reduced the glycosylation and total expression of EGFR, leading to diminished phosphorylation of both EGFR and downstream ERK1/2 . This disruption of the EGFR/ERK signaling pathway resulted in altered cell cycle progression, with increased accumulation of Cyclin C (a G1 phase marker) in RPN2-silenced cells .

Mechanistically, the impaired glycosylation of receptor tyrosine kinases like EGFR affects their membrane localization, stability, and signaling capacity. Research has demonstrated that RPN2 knockdown shifts the predominant localization of EGFR from the plasma membrane to intracellular compartments, thereby reducing its accessibility to extracellular ligands and impairing downstream signaling .

Studies in bladder cancer models have similarly shown that RPN2 knockdown suppresses epithelial-mesenchymal transition (EMT) and inhibits the PI3K-Akt pathway, further demonstrating Rpn2's role in regulating multiple oncogenic signaling cascades through glycosylation mechanisms .

What is the evidence for Rpn2 as a prognostic biomarker in cancer research?

Substantial evidence supports Rpn2's role as a prognostic biomarker across multiple cancer types:

  • Expression correlation with tumor characteristics: Higher RPN2 mRNA levels have been positively correlated with advanced tumor stage, lymph node metastasis, and poor pathological differentiation in bladder cancer patients .

  • Association with clinical outcomes: Elevated RPN2 expression has been linked to poorer prognosis in breast, colorectal, and bladder cancers, suggesting its potential utility as a prognostic indicator .

  • Cancer stem cell connection: RPN2 is highly expressed in breast cancer stem cells and associated with tumor metastasis, indicating its potential role in identifying aggressive cancer phenotypes .

  • Correlation with tumor size: Clinicopathological analysis has demonstrated that overexpression of RPN2 and EGFR is positively correlated with colorectal tumor size, further supporting its potential value as a biomarker .

The clinical significance of these findings is underscored by the consistent pattern across multiple cancer types, suggesting that Rpn2 expression analysis could potentially serve as a valuable addition to current prognostic assessment methods.

How does modulation of Rpn2 affect signaling pathway activities in experimental models?

Signaling PathwayEffect of Rpn2 KnockdownEffect of Rpn2 OverexpressionKey ReadoutsReference
EGFR/ERK PathwayDecreased phosphorylation of EGFR (Y1068) and ERK1/2 (T202/Y204, T185/Y187)Increased phosphorylation of EGFR and ERK1/2Western blot for p-EGFR, p-ERK1/2
PI3K-Akt PathwaySuppressed pathway activationEnhanced pathway activationWestern blot for p-Akt
Cell Cycle RegulationIncreased Cyclin C expression (G1 phase marker)Decreased Cyclin C expressionWestern blot, flow cytometry
EMT SignalingInhibition of EMT markersPromotion of EMT markersWestern blot for E-cadherin, N-cadherin, vimentin

Experimental evidence demonstrates that Rpn2 modulation affects these pathways primarily through altering the glycosylation status of key receptor proteins. For instance, in colorectal cancer models, RPN2 silencing reduced EGFR glycosylation, leading to decreased membrane localization and impaired signaling capacity . Similarly, rescue experiments in which RPN2 expression was restored in knockdown cells showed partial recovery of both glycosylation patterns and signaling pathway activities, confirming the specificity of these effects .

What are the critical methodological challenges when working with recombinant mouse Rpn2?

Working with recombinant mouse Rpn2 presents several methodological challenges that researchers should consider:

  • Membrane protein expression and purification: As an integral membrane protein, Rpn2 is difficult to express and purify in its native conformation. Expression systems that support proper protein folding and post-translational modifications (such as mammalian or insect cell systems) are preferable to bacterial systems.

  • Functional assessment complexity: Since Rpn2 functions as part of the larger OST complex rather than as an individual enzyme, assessing its activity requires either reconstitution of the complex or indirect measurements through substrate glycosylation.

  • Knockdown efficiency variability: When using RNA interference approaches, knockdown efficiency can vary significantly between experiments and cell types. In published studies, successful knockdown has typically achieved 90% reduction in RPN2 expression , but lower efficiencies may yield inconsistent results.

  • Distinguishing direct from indirect effects: As a glycosylation machinery component, Rpn2 modulation can have wide-ranging effects on multiple glycoproteins. Carefully designed controls and time-course experiments are essential to distinguish primary from secondary effects.

  • Potential lethality of complete knockout: Given Rpn2's essential role in N-linked glycosylation, complete knockout may be lethal in many cell types, necessitating inducible or partial knockdown approaches for functional studies.

How can researchers differentiate between glycosylation defects and protein stability issues when studying Rpn2?

Differentiating between primary glycosylation defects and secondary protein stability issues is critical when studying Rpn2 function. Several experimental approaches can help make this distinction:

  • PNGase F treatment comparisons: Treating cell lysates with PNGase F to remove all N-linked glycans provides a reference point for fully deglycosylated proteins. In RPN2 knockdown studies, EGFR showed a molecular weight decrease compared to control cells, with further decrease following PNGase F treatment—indicating partial rather than complete loss of glycosylation .

  • Proteasome inhibitor studies: Treatment with proteasome inhibitors like MG-132 can help determine if reduced protein levels result from degradation due to improper glycosylation. Research has shown that MG-132 treatment increases EGFR expression in RPN2-silenced cells, suggesting enhanced proteasomal degradation of improperly glycosylated proteins .

  • Time-course experiments: Monitoring changes in glycosylation status and protein levels over time following Rpn2 modulation can help establish the sequence of events—whether glycosylation defects precede or follow changes in protein stability.

  • mRNA expression analysis: Assessing mRNA levels of putative Rpn2 target proteins can determine whether observed protein reductions result from post-translational mechanisms (like impaired glycosylation leading to degradation) rather than transcriptional effects.

  • Subcellular localization studies: Immunofluorescence microscopy can reveal whether proteins with altered glycosylation show changes in cellular localization before degradation. Studies have demonstrated that RPN2 knockdown alters EGFR localization from plasma membrane to intracellular compartments , which may precede degradation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.