Recombinant Mouse Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (Dad1)

Shipped with Ice Packs
In Stock

Description

Introduction to Mouse Dad1 Protein

The Defender Against Apoptotic Death-1 (Dad1) protein plays dual roles in cellular function, serving both as a protective agent against programmed cell death and as a crucial component in glycosylation processes. This protein was first identified as a negative regulator of programmed cell death, with its loss triggering apoptotic pathways in cells . In its native context, Dad1 represents an essential subunit of the oligosaccharyltransferase (OST) complex, which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues in newly synthesized proteins .

Mouse Dad1 shares significant structural and functional homology with its human counterpart, making it an excellent model for investigating the role of this protein in mammalian systems. The creation of recombinant versions of mouse Dad1 has facilitated detailed investigations into its structure, function, and potential therapeutic applications. These recombinant proteins are typically produced through bacterial expression systems, purified via affinity chromatography, and made available for various research applications .

Physical and Biochemical Properties

Recombinant mouse Dad1 shares key structural features with the native protein while incorporating modifications to facilitate laboratory applications. The standard recombinant form is expressed with an N-terminal histidine tag to enable affinity purification and detection in experimental settings .

PropertyCharacteristicSource
Molecular Weight~12 kDa
Amino Acid Length112 residues (positions 2-113)
Expression SystemE. coli
TagN-terminal His-tag
Theoretical pIApproximately 7.0 (based on human homolog)
Physical FormLyophilized powder

Role in N-linked Glycosylation

Dad1 functions as an essential subunit of the oligosaccharyltransferase (OST) complex that catalyzes a critical step in N-linked glycosylation . This process involves the transfer of high-mannose oligosaccharides from lipid-linked oligosaccharide donors to asparagine residues within the consensus sequence Asn-X-Ser/Thr in nascent polypeptide chains . This post-translational modification occurs cotranslationally as proteins are being synthesized and translocated across the endoplasmic reticulum membrane.

The OST complex containing Dad1 associates with the Sec61 complex at the channel-forming translocon that mediates protein translocation across the endoplasmic reticulum . This strategic positioning ensures that glycosylation occurs efficiently during protein synthesis and folding. Studies using recombinant Dad1 have helped elucidate these fundamental aspects of protein glycosylation, which is essential for proper protein folding, stability, and function.

Anti-apoptotic Activity

Beyond its role in glycosylation, Dad1 was initially identified as a negative regulator of programmed cell death . The protein's name - Defender Against apoptotic Death-1 - reflects this critical function. Research has shown that the loss of Dad1 protein can trigger apoptotic pathways, suggesting its importance in maintaining cellular viability under normal physiological conditions .

Studies utilizing recombinant Dad1 have helped elucidate the mechanisms through which this protein exerts its anti-apoptotic effects. There appears to be a complex relationship between Dad1's glycosylation function and its role in preventing cell death, with disruptions in glycosylation potentially serving as a trigger for apoptotic pathways when Dad1 is absent or dysfunctional.

Expression Systems

Recombinant mouse Dad1 is typically produced using bacterial expression systems, with Escherichia coli being the most common host organism . The gene encoding mouse Dad1 is cloned into appropriate expression vectors, often incorporating affinity tags such as polyhistidine (His) tags to facilitate purification . The recombinant protein generally encompasses amino acids 2-113 of the mature protein, representing the functional domain of Dad1.

Purification and Processing

After expression in bacterial systems, recombinant Dad1 is purified using affinity chromatography, typically leveraging the incorporated His-tag . Following purification, the protein undergoes quality control assessments, including SDS-PAGE analysis to verify size and purity . Commercial preparations of recombinant mouse Dad1 typically achieve purity levels greater than 90%, as determined by SDS-PAGE analysis .

The purified protein is generally available in lyophilized form, requiring reconstitution before use in experimental applications . Recommended reconstitution conditions include dissolving in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of glycerol (5-50% final concentration) for long-term storage to prevent freeze-thaw damage .

Analytical Applications

Recombinant mouse Dad1 serves as a valuable tool in various analytical applications. It is commonly used as a standard in enzyme-linked immunosorbent assays (ELISA) designed to detect and quantify Dad1 in biological samples . These assays employ a sandwich ELISA format, where antibodies specific to Dad1 are used to capture the protein from samples, followed by detection with biotin-conjugated antibodies and streptavidin-HRP complexes .

Dad1 is also frequently analyzed via SDS-PAGE to assess protein expression, processing, and interactions . Such applications are crucial for understanding the role of Dad1 in normal cellular processes and in pathological conditions involving disrupted glycosylation or apoptotic regulation.

Functional Studies

Recombinant Dad1 enables detailed investigations into the protein's functional roles in glycosylation and apoptotic regulation. Researchers utilize the purified protein to study enzyme kinetics, substrate specificity, and structural requirements for Dad1's activity within the OST complex. Additionally, recombinant Dad1 facilitates the identification and characterization of protein-protein interactions, such as its documented interaction with the anti-apoptotic protein MCL1 .

Embryonic Development

Studies using mouse models with Dad1 gene knockout have revealed the critical importance of this protein in embryonic development. Embryos homozygous for Dad1 null mutations exhibit abnormal N-glycosylated proteins and show developmental delays by embryonic day 7.5 . These mutants display aberrant morphology, impaired mesodermal development, and increased levels of apoptosis in specific tissues .

The developmental defects associated with Dad1 deficiency ultimately prove fatal, with homozygous embryos failing to turn the posterior axis and dying by embryonic day 10.5 . These findings underscore the essential nature of Dad1-mediated glycosylation and its anti-apoptotic function during mammalian development.

Tissue-Specific Functions

Beyond its general role in development, Dad1 appears to have tissue-specific functions that are particularly critical in certain developmental contexts. The increased apoptosis observed in specific tissues of Dad1-deficient embryos suggests differential requirements for this protein across various cell types and developmental stages . Recombinant Dad1 has been instrumental in identifying these tissue-specific requirements through complementation studies and in vitro modeling of developmental processes.

Quality Control Considerations

Quality control measures for recombinant Dad1 typically include verification of protein size and purity via SDS-PAGE analysis, with commercial preparations generally achieving >90% purity . Additional quality control assessments may include mass spectrometry to confirm protein identity and functional assays to verify biological activity.

For researchers working with recombinant Dad1, it is advisable to verify the protein's quality and activity through appropriate validation experiments before proceeding with more complex studies. This may include western blotting with Dad1-specific antibodies or functional assays assessing the protein's glycosylation activity or anti-apoptotic effects.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Dad1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-113
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
SASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFI SCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
Uniprot No.

Target Background

Function
DAD1 is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process marks the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally, and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are essential for optimal enzyme activity.
Database Links
Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is DAD1 and what is its primary biological role?

DAD1 (Defender Against Cell Death 1) was initially discovered in BHK21 cells as a negative regulator of programmed cell death, which is a process essential for normal organism development and tissue homeostasis . Subsequent studies revealed that DAD1 serves as a subunit of the mammalian oligosaccharyltransferase (OST) complex, where it is required for both the functional activity and structural integrity of this complex . The OST complex plays a critical role in N-linked glycosylation, a fundamental post-translational modification of proteins.

Unlike the inhibitor of apoptosis proteins (IAP) family, DAD1 does not contain any baculoviral IAP repeat (BIR) domains, indicating it operates through different mechanisms to regulate cell death . Alternative names for DAD1 include DAD-1, oligosaccharyl transferase subunit DAD1, and dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1, reflecting its role in glycosylation processes .

How does DAD1 function in N-linked glycosylation?

DAD1 functions as a non-catalytic component of the oligosaccharyltransferase complex, which is responsible for the transfer of oligosaccharide moieties to nascent polypeptides in the process of N-linked glycosylation . This complex is located in the endoplasmic reticulum and catalyzes a critical step in the biosynthesis of N-linked glycoproteins.

Studies using mouse models have demonstrated that the absence of DAD1 leads to the expression of abnormal N-linked glycoproteins . This abnormality in glycosylation is likely due to compromised structural integrity and function of the OST complex in the absence of DAD1. The connection between DAD1 and glycosylation is further supported by research showing that tunicamycin (an inhibitor of N-linked oligosaccharide biosynthesis) and PNGase F (an enzyme that cleaves N-linked glycans) produce effects similar to those observed with DAD1 depletion .

Methodologically, researchers can assess DAD1's role in glycosylation by analyzing cell surface glycans using fluorescently labeled lectins such as Concanavalin A (ConA) and Lens Culinaris agglutinin (LCA), which detect specific glycan structures affected by alterations in N-glycosylation pathways .

What phenotypes are observed in DAD1-deficient mouse models?

Mouse models with DAD1 deficiency exhibit several distinct phenotypes that highlight the critical role of this protein in development:

  • Embryonic lethality: Homozygous Dad1 null mice do not survive beyond embryonic day 10.5 .

  • Developmental delay: By embryonic day 7.5, Dad1-deficient embryos show significant developmental delay compared to wild-type counterparts .

  • Aberrant morphology: The mutant embryos display abnormal morphological features, including impaired mesodermal development .

  • Increased apoptosis: Specific tissues in Dad1-deficient embryos exhibit elevated levels of apoptosis .

  • Glycosylation defects: The mutant embryos express abnormal N-glycosylated proteins, consistent with DAD1's role in the oligosaccharyltransferase complex .

  • Failure to turn the posterior axis: This specific developmental defect precedes the eventual lethality observed in these embryos .

These findings collectively establish that DAD1 is essential for proper N-linked glycoprotein processing and cell survival during mouse embryonic development. The methodological approach of generating and analyzing null alleles for Dad1 has been instrumental in elucidating these in vivo functions.

What are the optimal conditions for storing and handling recombinant DAD1 protein?

The stability and activity of recombinant DAD1 protein are significantly influenced by storage conditions. Based on technical information for similar recombinant proteins:

  • Temperature considerations:

    • For long-term storage, maintain the protein at -20°C/-80°C .

    • The shelf life of liquid formulations is approximately 6 months at -20°C/-80°C .

    • Lyophilized forms offer extended stability, with a shelf life of up to 12 months at -20°C/-80°C .

  • Freeze-thaw cycles:

    • Repeated freezing and thawing is not recommended as it may compromise protein integrity .

    • For working stocks, store aliquots at 4°C for up to one week to minimize freeze-thaw damage .

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom .

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

    • For optimal stability, add glycerol to a final concentration of 5-50% (with 50% being typical) before aliquoting for long-term storage .

The methodological approach to preserving protein activity involves careful consideration of buffer composition, temperature, and minimizing physical stresses that could lead to denaturation or aggregation.

How can researchers validate the functionality of recombinant DAD1 in experimental systems?

Validating the functionality of recombinant DAD1 protein in experimental systems requires multiple approaches:

  • Structural integrity assessment:

    • SDS-PAGE analysis with expected molecular weight confirmation (typically appearing around 12-15 kDa) .

    • Purity verification (>85% purity is standard for research applications) .

  • Functional assays:

    • N-glycosylation activity: Monitor the glycosylation status of known N-glycosylated proteins (such as LOX) in the presence vs. absence of DAD1 .

    • Lectin binding assays: Use fluorescently labeled lectins (ConA and LCA) to detect changes in cell surface glycans when DAD1 is present or depleted .

    • Blocking assays: The recombinant protein can be used in blocking assays to validate antibody specificity .

  • Complementation studies:

    • Introduction of recombinant DAD1 into Dad1-null cells should rescue the glycosylation defects and potentially reduce apoptosis if the protein is functional.

    • When using tagged versions of the protein, researchers should verify that the tag does not interfere with function .

  • Interaction studies:

    • Co-immunoprecipitation to confirm proper integration into the oligosaccharyltransferase complex.

    • Analysis of interaction with other OST complex components to ensure proper protein-protein interactions.

These methodological approaches provide complementary data on both the structural integrity and functional capacity of recombinant DAD1 protein preparations.

What experimental systems are most suitable for studying DAD1 function?

Several experimental systems have proven valuable for investigating DAD1 function:

  • Cell culture models:

    • BHK21 cells: The original cell line in which DAD1 was discovered as an anti-apoptotic factor .

    • Cancer cell lines: MDA-MB-231 and U87 cells have been used successfully to study the role of OST complex components in glycosylation .

    • These cell lines show regulated expression of DAD1-dependent glycoproteins and can be manipulated under various conditions such as hypoxia, which enhances expression of proteins like LOX that serve as readouts for N-glycosylation .

  • Mouse models:

    • Dad1 knockout mice provide critical insights into the in vivo function of this protein during development .

    • Heterozygous Dad1 mice can be valuable for studying partial loss-of-function effects.

  • Yeast systems:

    • Saccharomyces cerevisiae has been used to study the role of Dad1 in regulating N-linked glycosylation and apoptotic cell death .

    • Yeast expression systems are also used to produce recombinant DAD1 protein for functional studies .

  • CRISPR/Cas9 gene editing:

    • Modern gene editing approaches allow for precise manipulation of Dad1 in various cell types .

    • sgRNAs targeting different genomic regions of Dad1 or related genes like DDOST have been effective in creating cellular models with altered glycosylation pathways .

The methodological decision regarding which experimental system to use should be guided by the specific research question, with consideration of species-specific differences in glycosylation pathways and DAD1 function.

What molecular mechanisms connect DAD1's roles in glycosylation and apoptosis regulation?

The dual function of DAD1 in both glycosylation and apoptosis regulation represents an intriguing intersection of cellular processes. Current evidence suggests several potential mechanisms linking these functions:

  • Glycosylation-dependent survival signaling:

    • N-linked glycosylation affects the folding, stability, and function of numerous cell surface receptors and signaling molecules involved in cell survival pathways.

    • DAD1-mediated proper glycosylation may be required for the correct functioning of these survival-promoting proteins.

  • ER stress response:

    • Defective N-glycosylation triggers endoplasmic reticulum (ER) stress, which can lead to apoptosis via the unfolded protein response (UPR).

    • In Dad1-deficient embryos, increased apoptosis is observed in specific tissues, suggesting tissue-specific sensitivity to disruptions in N-glycosylation .

    • The embryonic lethality by day 10.5 in Dad1-null mice may result from cumulative ER stress due to improper protein glycosylation .

  • Direct anti-apoptotic function:

    • While DAD1 lacks the characteristic BIR domains found in canonical inhibitor of apoptosis proteins , it may still have direct interactions with components of the apoptotic machinery.

    • The fact that DAD1 overexpression is observed in some human hepatocellular carcinomas suggests it may provide a survival advantage to cancer cells beyond its glycosylation function .

Methodologically, distinguishing between direct anti-apoptotic functions and indirect effects via glycosylation requires careful experimental design, such as creating DAD1 mutants that retain one function but lose the other, or by temporally separating glycosylation defects from apoptotic events through inducible expression systems.

How does DAD1 contribute to developmental processes during embryogenesis?

DAD1 plays a critical role in embryonic development, as evidenced by the severe phenotypes observed in Dad1-null mice:

  • Mesodermal development:

    • Dad1-deficient embryos show impaired mesodermal development by embryonic day 7.5 .

    • This suggests that DAD1-dependent glycosylation is particularly important for signals regulating mesoderm formation and differentiation.

  • Posterior axis formation:

    • A specific defect observed in Dad1-null embryos is their failure to turn the posterior axis .

    • This morphogenetic process requires complex cell movements and tissue remodeling, which may depend on properly glycosylated adhesion molecules and extracellular matrix components.

  • Tissue-specific apoptosis:

    • The increased levels of apoptosis in Dad1-deficient embryos occur in specific tissues rather than throughout the embryo .

    • This tissue specificity suggests differential requirements for DAD1 function across developing tissues, possibly reflecting varying dependencies on particular glycoproteins.

  • Temporal aspects:

    • Dad1-null embryos develop normally until around E7.5 before showing developmental delays and defects .

    • This timing may correspond to a developmental stage when maternal DAD1 protein or mRNA is depleted, or when specific DAD1-dependent glycoproteins become critical for development.

Methodologically, techniques such as tissue-specific conditional knockouts, lineage tracing combined with apoptosis markers, and glycoproteomic analysis of affected tissues would provide further insights into the developmental roles of DAD1.

What is the potential role of DAD1 in carcinogenesis and cancer progression?

Several lines of evidence suggest DAD1 may play significant roles in cancer biology:

  • Overexpression in hepatocellular carcinoma:

    • DAD1 mRNA overexpression has been reported in some human hepatocellular carcinomas .

    • This suggests DAD1 may provide advantages to cancer cells, potentially through enhanced glycosylation capacity or direct anti-apoptotic effects.

  • Glycosylation alterations in cancer:

    • Altered glycosylation patterns are a hallmark of cancer cells, affecting processes including immune evasion, metastasis, and drug resistance.

    • As a component of the oligosaccharyltransferase complex, DAD1 may contribute to these cancer-associated glycosylation changes.

  • Resistance to apoptosis:

    • Cancer cells typically develop mechanisms to evade apoptosis.

    • DAD1's role as a negative regulator of programmed cell death suggests it could potentially be exploited by cancer cells to enhance survival.

  • Hypoxia adaptation:

    • Hypoxic conditions in tumors induce expression of proteins like LOX, which require N-glycosylation for proper function .

    • DAD1-mediated glycosylation may be particularly important under these stress conditions common in the tumor microenvironment.

Methodologically, approaches to study DAD1 in cancer contexts include: comparative expression analysis across tumor types and stages; functional studies using cancer cell lines with DAD1 knockdown or overexpression; analysis of glycosylation patterns in tumors with varying DAD1 levels; and investigation of DAD1's potential as a therapeutic target using selective inhibitors of the OST complex.

What techniques are most effective for analyzing N-linked glycosylation changes related to DAD1 function?

Several complementary techniques can effectively characterize glycosylation changes related to DAD1 function:

  • Protein migration analysis:

    • SDS-PAGE followed by western blotting for specific glycoproteins can reveal shifts in apparent molecular weight due to altered glycosylation .

    • For example, LOX has been used as a reporter protein, showing reduced apparent mass when N-glycosylation is inhibited by tunicamycin or when treated with PNGase F .

  • Glycan-specific lectin binding:

    • Fluorescently labeled lectins with distinct glycan binding preferences provide valuable tools:

      • Concanavalin A (ConA) detects α-linked mannose structures

      • Lens Culinaris agglutinin (LCA) detects both α-linked mannose and core fucosylated N-glycans

    • Flow cytometry analysis of lectin binding to cells with various DAD1 expression levels can quantify changes in surface glycan patterns.

  • Enzymatic deglycosylation:

    • Comparing protein mobility before and after treatment with glycosidases like PNGase F helps confirm the presence and extent of N-glycosylation .

    • Different glycosidases with distinct specificities can reveal the types of glycans affected by DAD1 alterations.

  • Mass spectrometry:

    • Glycoproteomic approaches can provide detailed structural information about the glycans affected by DAD1 deficiency.

    • Site-specific glycan analysis can identify which glycosylation sites on target proteins are most dependent on DAD1 function.

  • Genetic manipulation approaches:

    • CRISPR/Cas9-mediated gene editing with sgRNAs targeting DAD1 or other OST complex components provides a clean system for studying glycosylation changes .

    • The comparison between non-targeting controls and DAD1-targeted cells reveals DAD1-specific effects.

The methodological principle underlying effective glycosylation analysis is the combination of multiple complementary techniques to build a comprehensive understanding of how DAD1 affects the glycoproteome.

How can researchers accurately distinguish between DAD1's direct effects on apoptosis versus indirect effects via altered glycosylation?

Distinguishing between direct anti-apoptotic functions and glycosylation-mediated effects requires sophisticated experimental approaches:

  • Structure-function analysis:

    • Generate DAD1 mutants that retain OST complex integration but lose anti-apoptotic function (or vice versa).

    • Perform complementation studies in Dad1-null cells to determine which functions can be independently rescued.

  • Temporal separation approaches:

    • Use inducible expression systems to rapidly modulate DAD1 levels and monitor glycosylation and apoptotic responses over time.

    • If apoptotic effects precede detectable glycosylation changes, this would suggest direct anti-apoptotic functions.

  • Comparative OST complex manipulations:

    • Target different OST complex components (not just DAD1) and compare apoptotic phenotypes.

    • If only DAD1 depletion triggers apoptosis while other components primarily affect glycosylation, this would support direct anti-apoptotic roles.

  • Bypass experiments:

    • Artificially maintain proper glycosylation through alternative means in DAD1-deficient cells.

    • Determine if apoptosis still occurs despite restored glycosylation.

  • Protein interaction studies:

    • Investigate direct binding partners of DAD1 beyond the OST complex.

    • Identify potential interactions with apoptotic regulatory proteins that could explain direct effects.

These methodological approaches should be complemented by careful quantification of both glycosylation status and apoptotic markers to establish causal relationships between DAD1 function and cellular outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.