Recombinant Mouse Dual oxidase maturation factor 1 (Duoxa1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Duoxa1; Dual oxidase maturation factor 1; Dual oxidase activator 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Duoxa1
Target Protein Sequence
MAALGHTLPFYTGTKPTFPMDTTLAVIITIFLTALVTFIIILPGIRGKTRLFWLLRVVTS LFIGAVILAVNFSSEWSVGHVNANTTYKAFSPKWVSVDVGLQIGLGGVNITLTGTPVQQL NETINYNEAFAWRLGRSYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYNQYRLAGHYA SAMLWVAFLCWLLANVMLSMPVLVYGGHMLLATGLFQLLALFFFSMTTSLISPCPLRLGT AVLHTHHGPAFWITLATGLLCILLGLVMAVAHRMQPHRLKAFFNQSSEDPVLEWGSEEGG LLSPHYRSIAESPETQDIPMSVASSETCFKEEHPKESDCSL
Uniprot No.

Target Background

Function
DUOXA1 may be essential for the maturation and transport of functional DUOX1 from the endoplasmic reticulum to the plasma membrane.
Gene References Into Functions
  1. In Duoxa-/- mice, proliferation and migration of granule cells were delayed after P15. However, these changes resolved by P25. While the cerebellar structure of Duoxa-/- mice did not significantly differ from wild-type mice at P25, motor coordination was impaired. Additionally, the amplitude of paired-pulse facilitation at parallel fiber-Purkinje cell synapses decreased in Duoxa-/- mice. PMID: 26914863
  2. Overexpression of DUOXA1 in muscle stem cells induces apoptosis and inhibits differentiation through DUOX1 and ASK1. PMID: 24410844
  3. DUOXA1 is a novel p53-regulated neurogenic factor involved in p53-dependent neuronal differentiation. PMID: 21362455
  4. Nip1 plays a significant role in guiding neuronal differentiation through ROS generation and modulation of intermediate filaments. PMID: 20233719
Database Links
Protein Families
DUOXA family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Duoxa1 in Duox1 activity?

Duoxa1 functions as an essential maturation factor for Duox1, enabling the formation of an active enzyme complex that catalyzes the production of hydrogen peroxide. The Duox1-Duoxa1 complex plays crucial roles in various tissues, including thyroid and respiratory tract, contributing to processes such as thyroid hormone biosynthesis and innate host defense . Methodologically, researchers can study this relationship through co-immunoprecipitation assays or by assessing hydrogen peroxide production in systems with and without functional Duoxa1. When Duox1 is expressed without Duoxa1, it fails to properly traffic to the plasma membrane and remains inactive, highlighting the critical maturation function of Duoxa1.

What are the key structural domains of mouse Duoxa1?

Mouse Duoxa1 contains a complex multidomain structure that includes an extracellular domain and five transmembrane helices (TM1-5), though only four are well-resolved in current structural studies . The extracellular domain features two short helices held in a palm-like structure formed by four β strands and one loop. Specific glycosylation sites have been identified at residues Asn84 and Asn109 . For experimental work, researchers should consider these post-translational modifications when designing expression systems, as proper glycosylation may be critical for functional studies of recombinant Duoxa1 proteins.

How does Duoxa1 interact with Duox1 at the molecular level?

Cryo-EM structural studies have revealed that Duox1 and Duoxa1 interact via three distinct interfaces :

  • Interface #1: Involves the peroxidase homology domain (PHD) of Duox1 and the extracellular domain of Duoxa1, burying a surface area of approximately 987 Ų.

  • Interface #2: Located at the transmembrane region.

  • Interface #3: Forms at the intracellular side of the membrane.

These interactions are stabilized by specific intramolecular disulfide bonds, including Cys167-Cys234 within Duoxa1 . Notably, previously proposed intermolecular disulfide bridges were not observed in current structural studies, suggesting that our understanding of these interactions continues to evolve. Researchers investigating these interactions should employ site-directed mutagenesis approaches targeting specific residues at these interfaces to elucidate their functional significance.

What expression systems are optimal for producing functional recombinant mouse Duoxa1?

For functional studies of mouse Duoxa1, mammalian expression systems are typically preferred over bacterial or insect cell systems due to the requirement for proper post-translational modifications, particularly glycosylation at sites Asn84 and Asn109 . When designing expression constructs, researchers should consider:

  • Full-length vs. truncated constructs: Full-length constructs preserve all functional domains but may present purification challenges due to multiple transmembrane regions.

  • Fusion tags: GST tags have been successfully employed for purification purposes , though careful placement is essential to avoid interfering with Duox1 interaction surfaces.

  • Co-expression with Duox1: For functional studies, co-expression with Duox1 is often necessary as the two proteins form a functional complex.

For structural studies, size exclusion chromatography has demonstrated that purified mouse full-length Duox1-Duoxa1 complexes migrate as two overlapping peaks, indicating the presence of complexes with different stoichiometries—likely heterodimer and dimer-of-dimer fractions .

What purification strategies yield high-purity recombinant Duoxa1 suitable for structural studies?

Based on recent successful structural studies, a multi-step purification protocol is recommended:

  • Affinity chromatography: Using appropriately tagged constructs (e.g., GST-tagged Duoxa1) .

  • Size exclusion chromatography: Critical for separating different oligomeric states of the Duox1-Duoxa1 complex .

  • Protein quality assessment: Evaluation of glycosylation status and membrane protein integrity prior to structural analysis.

When preparing samples for cryo-EM analysis, researchers should be aware that even with careful size exclusion chromatography, peak overlapping may occur, resulting in mixed populations of heterodimeric and dimer-of-dimer states . This necessitates careful classification during image processing to separate distinct conformational states.

How can researchers accurately measure Duoxa1-dependent Duox1 activity?

Multiple complementary approaches can be employed to assess Duoxa1-dependent Duox1 activity:

  • H₂O₂ production assays: The most direct measure of functional activity, utilizing fluorescent or luminescent H₂O₂-sensitive probes. Critical controls should include Duox1 expression without Duoxa1 and the use of specific inhibitors or catalase to confirm signal specificity .

  • Calcium dependency: Since Duox1 is calcium-dependent, researchers should incorporate calcium mobilization assays to correlate cytosolic [Ca²⁺] increases with H₂O₂ generation . Irradiation has been shown to induce increases in cytosolic [Ca²⁺] in thyroid cells at day 4 post-treatment, consistent with activation of the calcium-dependent H₂O₂-generating activity of Duox1 .

  • Trafficking assays: Fluorescently tagged Duox1 can be used to monitor proper trafficking to the plasma membrane in the presence or absence of functional Duoxa1.

What are the key regulatory factors that modulate Duoxa1 function?

Several regulatory factors have been identified that modulate Duoxa1 expression and function:

  • IL-13 signaling: IL-13 has been demonstrated to regulate radiation-induced increases in Duox1 expression, with neutralizing IL-13 antibodies abrogating radiation-induced H₂O₂ production .

  • p38 MAPK pathway: p38 MAPK down-regulation by RNA interference counteracts the selective up-regulation of DUOXA1 (+ exon 6) mRNA expression induced by irradiation .

  • H₂O₂ feedback loop: Interestingly, H₂O₂ itself can reproduce the effect of irradiation on Duox1 expression, suggesting a positive feedback mechanism .

Researchers studying regulatory pathways should employ specific inhibitors or RNA interference approaches targeting these pathways to elucidate their relative contributions to Duoxa1 regulation.

How do the different oligomeric states of the Duox1-Duoxa1 complex affect function?

Recent structural analyses have revealed that the Duox1-Duoxa1 complex can exist in both heterodimeric and dimer-of-dimer configurations . The functional significance of these different oligomeric states is particularly interesting:

  • Heterodimeric state: Likely represents the active form of the complex.

  • Dimer-of-dimer configuration: Biochemical and structural analyses indicate this configuration may represent an inactive state of Duox1-Duoxa1, suggesting an oligomerization-dependent regulatory mechanism .

This structural insight provides a potential mechanism for regulating Duox1 activity through controlling oligomeric assembly. Researchers investigating these oligomeric transitions should consider employing techniques such as native mass spectrometry or analytical ultracentrifugation to characterize the equilibrium between these states under different conditions.

What structural features are critical for Duoxa1 maturation function?

The maturation function of Duoxa1 depends on several structural features:

  • Transmembrane domain interactions: The transmembrane helices of Duoxa1 interact with corresponding regions in Duox1, facilitating proper folding and trafficking.

  • Extracellular domain: The extracellular domain of Duoxa1 interacts with the peroxidase homology domain (PHD) of Duox1, potentially stabilizing its conformation .

  • Specific residues mediating protein-protein interactions: Mutations affecting these interactions could impair the maturation function.

Experimentally, researchers can employ alanine scanning mutagenesis or domain swapping approaches to identify specific regions critical for the maturation function, followed by trafficking assays to assess the impact on Duox1 membrane localization.

How does Duoxa1 contribute to radiation-induced genomic instability?

Studies have established a critical role for Duoxa1 in radiation-induced genomic instability through several mechanisms:

  • Persistent ROS generation: Irradiation induces chronic H₂O₂ production via Duox1 up-regulation, which depends on proper Duoxa1 function .

  • DNA damage: Duox1-dependent H₂O₂ production leads to DNA double-strand breaks (DSBs), detectable through γH2AX and 53BP1 foci formation .

  • Cell cycle checkpoint activation: This DNA damage results in activation of checkpoint kinase 2 (Chk2) and cell growth arrest .

The table below summarizes the experimental timeline for radiation-induced effects on the Duox1-Duoxa1 system:

Time after irradiationObserved effects
Day 1Initial increase in Chk2 phosphorylation
Day 2Increase in γH2AX levels begins
Day 4Peak H₂O₂ production; formation of γH2AX and 53BP1 foci; increased IL-13 protein; increased cytosolic [Ca²⁺]
Day 7Sustained IL-13 protein elevation; persistent H₂O₂ production
Day 10Sustained Chk2 phosphorylation

Critically, DUOX1 inactivation leads to a significant reduction in radiation-induced H₂O₂ production and approximately 50% reduction in DNA-damage foci .

What is the relationship between Duoxa1 splicing variants and functional activity?

Analysis of Duoxa1 mRNA indicates the presence of splice variants with differential expression patterns following irradiation:

  • The splice variant containing exon 6 appears to be selectively increased in a dose-dependent manner following irradiation .

  • This specific splice variant encodes an active form of Duoxa1 that supports Duox1 function.

The regulation of this splicing event involves p38 MAPK, as p38 MAPK down-regulation by RNA interference counteracts the selective up-regulation of Duoxa1 (+ exon 6) mRNA expression induced by irradiation . For researchers studying Duoxa1 splice variants, RT-PCR analysis with primers spanning relevant exon junctions is essential to distinguish between different splice forms.

What are the key differences between mouse and human Duoxa1?

Mouse and human Duoxa1 share significant sequence homology, though several differences should be considered when translating findings between species:

  • Sequence conservation: Mouse Duox1 shares approximately 91% sequence identity with its human ortholog , with Duoxa1 showing similar high conservation.

  • Functional conservation: Both mouse and human Duoxa1 serve as maturation factors for their respective Duox1 proteins, suggesting conserved functionality.

  • Expression patterns: While generally similar, tissue-specific expression patterns may vary between species and should be verified experimentally.

When designing experiments using mouse models to study processes relevant to human health, researchers should validate key findings in human cell systems to ensure translational relevance.

How can mouse Duoxa1 studies inform therapeutic approaches for human diseases?

Research on mouse Duoxa1 has significant translational potential:

  • Cancer relevance: Analysis of human thyroid tumors from patients with radiation exposure history shows that DUOX1 gene expression is significantly higher in radio-induced thyroid tumors compared to normal thyroid tissues .

  • Targeting regulatory pathways: The identification of IL-13 and p38 MAPK as regulators of Duoxa1/Duox1 expression suggests potential therapeutic targets .

  • Oxidative stress modulation: Understanding how Duoxa1 regulates Duox1-dependent H₂O₂ production may inform strategies to mitigate oxidative stress in various pathological contexts.

For therapeutic development, researchers should consider targeting the Duox1-Duoxa1 system at multiple levels, including protein-protein interactions, transcriptional regulation, and post-translational modifications.

What are common technical challenges in working with recombinant Duoxa1?

Researchers frequently encounter several technical challenges when working with recombinant Duoxa1:

  • Protein solubility: As a membrane protein with multiple transmembrane domains, Duoxa1 presents solubility challenges. Solution: Use of appropriate detergents or nanodiscs for structural and biochemical studies.

  • Co-expression requirements: Functional studies often require co-expression with Duox1. Solution: Develop bicistronic expression systems or stable cell lines expressing both proteins.

  • Post-translational modifications: Ensuring proper glycosylation at sites like Asn84 and Asn109 . Solution: Use of mammalian expression systems rather than bacterial systems.

  • Functional assessment: Distinguishing Duoxa1-specific effects from other maturation factors. Solution: Careful design of control experiments, including Duoxa1 knockdown/knockout approaches.

How can researchers effectively investigate Duoxa1-Duox1 interactions in cellular systems?

Several methodologies can be employed to study Duoxa1-Duox1 interactions in cellular contexts:

  • Proximity ligation assays: Allowing detection of protein-protein interactions in situ with high sensitivity.

  • FRET/BRET approaches: For real-time monitoring of interactions in live cells.

  • Co-immunoprecipitation: For biochemical verification of physical interactions.

  • Cellular localization studies: As Duox1 has been shown to be expressed both at the plasma membrane and in the perinuclear compartment , co-localization studies with Duoxa1 can provide insights into functional interactions.

When performing knockdown studies, researchers should note that DUOX1 inactivation affects the level of p38 MAPK phosphorylation analyzed at day 7 post-irradiation, indicating that DUOX1 contributes to long-term maintenance of radiation-induced effects . This highlights the importance of temporal considerations in experimental design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.