Recombinant Mouse Dual oxidase maturation factor 2 (Duoxa2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Duoxa2; Dual oxidase maturation factor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTAWDGVLPFYPQPRHAASFSVPLLIVILVFLSLAASFLFILPGIRGHSRWFWLVRVLLS LFIGAEIVAVHFSGDWFVGRVWTNTSYKAFSPSRVQVHVGLHVGLAGVNITLRGTPRQQL NETIDYNERFTWRLNEDYTKEYVHALEKGLPDPVLYLAEKFTPSSPCGLYHQYHLAGHYA AATLWVAFCFWIIANALLSMPAPLYGGLALLTTGAFTLFGVFAFASISSVPLCHFRLGSA VLTPYYGASFWLTLATGILSLLLGGAVVILHYTRPSALRSFLDLSVKDCSNQAKGNSPLT LNNPQHEQLKSPDLNITTLL
Uniprot No.

Target Background

Function
Essential for the maturation and transport of functional DUOX2 from the endoplasmic reticulum to the plasma membrane. May play a role in thyroid hormone synthesis.
Database Links
Protein Families
DUOXA family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is mouse Duoxa2 and what is its biological function?

Mouse Dual oxidase maturation factor 2 (Duoxa2) is a 320-amino acid transmembrane protein that plays a crucial role in the maturation and activation of dual oxidase 2 (DUOX2). Duoxa2 facilitates the proper migration of DUOX2 from the endoplasmic reticulum (ER) to the plasma membrane, where the two proteins form a stable complex. This complex is essential for hydrogen peroxide (H₂O₂) generation, which is required for thyroid hormone synthesis. Specifically, the Duoxa2-DUOX2 complex enables the oxidation of iodide during thyroid hormone formation .

The protein has several transmembrane domains and functions primarily as a maturation factor rather than possessing enzymatic activity itself. In the absence of Duoxa2, DUOX2 remains trapped in the ER, leading to impaired H₂O₂ production and subsequent disruption of thyroid hormone synthesis .

How should recombinant mouse Duoxa2 be stored and reconstituted for experimental use?

Recombinant mouse Duoxa2 is typically supplied as a lyophilized powder and requires proper storage and reconstitution for optimal experimental results. The recommended storage protocol is:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Avoid repeated freeze-thaw cycles by creating working aliquots

  • Working aliquots can be stored at 4°C for up to one week

For reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (default recommendation is 50%)

  • Aliquot for long-term storage at -20°C/-80°C

The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0. Careful handling during reconstitution is essential to maintain protein stability and functionality for downstream applications .

How can researchers assess the functional activity of recombinant Duoxa2 in experimental settings?

Assessing the functional activity of recombinant Duoxa2 requires evaluation of its ability to facilitate DUOX2 maturation and subsequent H₂O₂ generation. A validated methodological approach involves:

  • Co-expression system: Transiently transfect HeLa cells (or similar mammalian cell lines) with HA-DUOX2 and DUOXA2-Myc/His constructs along with a β-Gal expressing plasmid (for normalization of transfection efficiency)

  • H₂O₂ measurement: Add Amplex Red reagent to the medium and measure fluorescence using a microplate reader (e.g., Infinite M1000 Pro). The Amplex Red reacts with H₂O₂ in a 1:1 stoichiometry to produce highly fluorescent resorufin

  • Normalization: Adjust values for transfection efficiency by quantifying β-Gal activity

  • Controls: Include wild-type DUOX2-DUOXA2 complex as a positive control (set to 100%) and empty vector transfection as a negative control

  • Data analysis: Calculate relative H₂O₂ generation as a percentage of wild-type activity

This experimental setup enables quantitative assessment of Duoxa2 functionality and can be used to evaluate the impact of mutations or structural modifications on Duoxa2 activity .

What are the molecular consequences of Duoxa2 deficiency in mouse models?

Studies in Duoxa-deficient mice (Duoxa⁻/⁻) have revealed several important molecular consequences:

  • DUOX protein maturation defects: Knockout of Duoxa genes leads to impaired processing of N-glycans in the Golgi apparatus for DUOX proteins

  • Subcellular localization: DUOX proteins fail to reach the plasma membrane and remain trapped in the ER

  • Functional impairment: Complete loss of H₂O₂ release from thyroid cells and other epithelial cells expressing DUOX enzymes

  • Phenotypic consequences: Severe hypothyroidism with developmental defects

  • Transcript analysis: Despite gene disruption, detectable amounts of mRNA from truncated Duoxa loci can still be identified by RT-PCR, with stable polyadenylated ΔDuoxa2 transcripts containing the introduced in-frame stop codon detected in thyroid tissue

The Duoxa⁻/⁻ mouse model provides an excellent system for studying complete DUOX deficiency and understanding the specific roles of the DUOX/DUOXA system in various tissues .

What experimental techniques are used to study Duoxa2-DUOX2 protein interactions?

Researchers employ several methodological approaches to investigate Duoxa2-DUOX2 interactions:

  • Co-immunoprecipitation (Co-IP): Using tagged versions of both proteins (e.g., HA-DUOX2 and DUOXA2-Myc/His) to pull down the complex and analyze by Western blotting

  • Fluorescence microscopy: Employing fluorescently-tagged constructs to visualize co-localization within cellular compartments

  • Glycosylation analysis: Examining the glycosylation status of DUOX2 in the presence or absence of Duoxa2 using endoglycosidase H and PNGase F treatments

  • Surface biotinylation assays: Quantifying plasma membrane localization of DUOX2 when co-expressed with wild-type or mutant Duoxa2

  • FRET/BRET analysis: For studying proximity and dynamic interactions between the proteins in living cells

These techniques collectively provide insights into how Duoxa2 facilitates the maturation, trafficking, and activation of DUOX2, and how mutations might disrupt these processes .

How do mutations in Duoxa2 impact thyroid function and development?

Mutations in Duoxa2 have significant implications for thyroid function through several mechanisms:

Mutation TypeMolecular EffectFunctional ConsequenceDisease Association
Biallelic mutationsSevere impairment of Duoxa2 functionComplete loss of DUOX2 activityPermanent congenital hypothyroidism
Monoallelic mutationsPartial reduction in Duoxa2 functionReduced H₂O₂ generationTransient or mild hypothyroidism
Variants of uncertain significanceVariable effects on protein functionPotentially increased susceptibilityThyroid dysgenesis (TD)

Research has shown that Duoxa2 variants are prominent in patients with thyroid dysgenesis (18.75% prevalence) and are also frequently observed in patients with gland-in-situ congenital hypothyroidism (23.60% prevalence). The functional impact of these mutations directly affects the ability of DUOX2 to generate H₂O₂ necessary for thyroid hormone synthesis .

Notably, genetic screening studies have identified biallelic mutations in 0.35% of patients with thyroid dysgenesis. These mutations disrupt the formation of the functional DUOX2-DUOXA2 complex, leading to impaired H₂O₂ generation and subsequent defects in thyroid hormone synthesis .

How can Duoxa2 genetic screening be employed in clinical research?

Duoxa2 genetic screening offers valuable insights for clinical research, particularly in the context of congenital hypothyroidism (CH). A methodological approach for implementing Duoxa2 screening includes:

  • Patient selection: Identify subjects with clinical features of CH, especially those with partial iodide organification defects

  • Sequencing approach: Employ targeted sequencing of the Duoxa2 gene, with attention to both coding regions and regulatory elements

  • Variant interpretation: Classify identified variants according to pathogenicity criteria, considering evolutionary conservation and functional predictions

  • Correlation analysis: Assess relationships between genotype and phenotype, including thyroid hormone levels, thyroid morphology, and response to treatment

  • Combinatorial screening: Combine Duoxa2 screening with analysis of other CH-associated genes for comprehensive genetic profiling

Research indicates that Duoxa2 gene screening enhances diagnostic accuracy in CH, though it should not be used as a sole diagnostic indicator. To optimize sensitivity, it should be combined with screening of other relevant genetic mutations and diagnostic tools .

What are the limitations of current Duoxa2 testing methodologies?

Current Duoxa2 testing approaches face several important limitations that researchers should consider:

  • Test sensitivity boundaries: Standard tests may not reliably detect:

    • Low-level mosaicism (variants with minor allele fraction below 14.6%)

    • Stretches of mononucleotide repeats

    • Indels larger than 50bp

    • Single exon deletions or duplications

    • Variants within pseudogene regions/duplicated segments

  • Technical exclusions: Most tests cannot detect:

    • Complex inversions

    • Gene conversions

    • Balanced translocations

    • Non-coding variants deeper than ±20 base pairs from exon-intron boundary

  • Functional validation challenges: Establishing the pathogenicity of novel variants requires complex functional studies

  • Tissue specificity: Germline testing does not address somatic variations that might affect Duoxa2 function in specific tissues

These limitations highlight the importance of choosing appropriate testing methodologies based on research questions and combining multiple approaches for comprehensive analysis .

What are the key considerations when working with recombinant mouse Duoxa2 in expression systems?

When designing experiments with recombinant mouse Duoxa2, researchers should consider several critical factors:

  • Expression system selection: While E. coli-expressed Duoxa2 is suitable for many applications including antibody production and protein-protein interaction studies, mammalian expression systems may be required for functional studies due to proper post-translational modifications

  • Tag selection and positioning: N-terminal His-tags are commonly used, but researchers should verify that the tag doesn't interfere with Duoxa2 function, especially in interaction studies with DUOX2

  • Co-expression requirements: For functional studies, co-expression with DUOX2 is essential as Duoxa2 functions primarily through facilitating DUOX2 maturation

  • Purification conditions: Optimize buffer conditions to maintain protein stability, considering that Duoxa2 is a transmembrane protein

  • Quality control metrics: Implement rigorous purity assessment (>90% by SDS-PAGE is standard) and functional validation before experimental use

  • Species considerations: While mouse Duoxa2 shares significant homology with human DUOXA2, species-specific differences may impact experimental interpretations in translational research

These considerations help ensure reliable and reproducible results when working with recombinant mouse Duoxa2 in various experimental settings .

How can researchers differentiate between DUOXA1 and DUOXA2 functions in experimental models?

Differentiating between DUOXA1 and DUOXA2 functions requires strategic experimental approaches:

  • Selective knockout/knockdown: Generate single knockouts/knockdowns of each gene to assess individual contributions versus double knockouts to assess redundancy

  • Tissue-specific analysis: Exploit differential expression patterns (DUOXA2 is predominantly expressed in thyroid while DUOXA1 has broader expression)

  • Selective reconstitution: In Duoxa-deficient models, reintroduce either DUOXA1 or DUOXA2 to determine specific rescue effects

  • Chimeric protein analysis: Create chimeric proteins swapping domains between DUOXA1 and DUOXA2 to identify functional specificity determinants

  • Partner selectivity studies: Assess preferential interactions with DUOX1 versus DUOX2 using co-immunoprecipitation and functional assays

Research has demonstrated that while both DUOXA proteins can support DUOX maturation, DUOXA2 appears more critical for thyroid function, as evidenced by the association of DUOXA2 mutations with congenital hypothyroidism. In contrast, DUOXA1 may play more diverse roles in extrathyroidal tissues .

What are emerging applications of recombinant mouse Duoxa2 in research beyond thyroid studies?

While Duoxa2 is well-established in thyroid research, emerging evidence suggests broader applications:

  • Epithelial immunity studies: The DUOX/DUOXA system contributes to epithelial immune homeostasis, particularly in intestinal epithelium, offering opportunities to investigate Duoxa2's role in host-microbe interactions

  • Redox signaling research: As facilitators of controlled H₂O₂ production, Duoxa2-DUOX2 complexes represent important models for studying regulated ROS generation in signal transduction

  • Developmental biology: The severe developmental phenotypes in Duoxa-deficient models suggest roles beyond thyroid function, warranting investigation in embryonic development

  • Cancer research: Altered redox signaling is implicated in cancer biology, and the controlled H₂O₂ generation through Duoxa2-DUOX2 may have relevance to tumor microenvironment studies

  • Comparative biology: Evolutionary conservation of the DUOX/DUOXA system from invertebrates to mammals suggests fundamental biological roles that can be explored using comparative approaches

These emerging directions present opportunities to leverage recombinant Duoxa2 and mouse models for investigating diverse physiological and pathological processes .

What technical challenges remain in studying Duoxa2-mediated processes?

Despite significant advances, several technical challenges persist in Duoxa2 research:

  • Structural characterization: The transmembrane nature of Duoxa2 makes crystallographic or cryo-EM studies challenging, limiting detailed structural understanding

  • Physiological regulation: Current understanding of how Duoxa2 expression and function are regulated under physiological and stress conditions remains incomplete

  • Tissue-specific roles: While thyroid functions are well-characterized, the specific roles of Duoxa2 in other tissues expressing the protein remain poorly defined

  • Interaction networks: Beyond DUOX2, the complete interactome of Duoxa2 and how these interactions might regulate its function remains to be fully elucidated

  • Therapeutic targeting: Developing approaches to modulate Duoxa2 function for therapeutic purposes in congenital hypothyroidism presents significant challenges

Addressing these challenges will require interdisciplinary approaches combining advanced genetic tools, protein biochemistry, and in vivo models to fully elucidate the biology of Duoxa2 and its therapeutic potential .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.