Recombinant Mouse Duffy antigen/chemokine receptor (Darc)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
Ackr1; Darc; Dfy; Fy; Atypical chemokine receptor 1; Duffy antigen/chemokine receptor; CD antigen CD234
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGNCLYPVETLSLDKNGTQFTFDSWNYSFEDNYSYELSSDYSLTPAAPCYSCNLLDRSSL PFFMLTSVLGMLASGSILFAILRPFFHWQICPSWPILAELAVGSALFSIAVPILAPGLHS AHSTALCNLGYWVWYTSAFAQALLIGCYACLNPRLNIGQLRGFTLGLSVGLWGAAALSGL PVALASDVYNGFCTFPSSRDMEALKYTHYAICFTIFTVLPLTLLAAKGLKIALSKGPGPW VSVLWIWFIFWWPHGMVLIFDALVRSKTVLLYTCQSQKILDAMLNVTEALSMLHCVATPL LLALFCHQTTRRSLSSLSLPTRQASQMDALAGKS
Uniprot No.

Target Background

Function
The Duffy antigen/chemokine receptor (DARC) is an atypical chemokine receptor that regulates chemokine levels and localization by binding chemokines with high affinity. This binding is not coupled with classic ligand-driven signal transduction cascades, instead, it leads to chemokine sequestration, degradation, or transcytosis. DARC is also known as an interceptor (internalizing receptor), chemokine-scavenging receptor, or chemokine decoy receptor. It exhibits a promiscuous chemokine-binding profile, interacting with inflammatory chemokines belonging to both the CXC and the CC subfamilies, but not with homeostatic chemokines. DARC serves as a receptor for various chemokines, including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, and TARC. DARC regulates chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines, leading to their presentation to circulating leukocytes; when expressed in erythrocytes, it serves as a blood reservoir for cognate chemokines and acts as a chemokine sink, buffering potential surges in plasma chemokine levels.
Gene References Into Functions
  1. Our research in mice suggests that DARC influences the severity and resolution of asthma. This finding is corroborated by our human analyses, where specific DARC single nucleotide polymorphisms (SNPs) are associated with poorer asthma control and symptoms. PMID: 28471517
  2. DARC expression was remarkably confined to post-capillary and small collecting venules, completely absent from arteries, arterioles, capillaries, veins, and most lymphatics in all tissues examined. Intravital microscopy revealed that leukocyte-endothelial adhesive interactions were restricted to DARC-positive venules. DARC was detectable across the entire circumference of vascular endothelial cells (V-ECs), but concentrated at cell-cell junctions. PMID: 28526034
  3. DARC regulates the recruitment of osteoclast precursors to inflammation sites. PMID: 27376530
  4. Nucleated erythroid cells exhibited high ACKR1 expression, facilitating direct contact with hematopoietic stem cells. The absence of erythroid ACKR1 altered mouse hematopoiesis, affecting stem and progenitor cells, ultimately leading to phenotypically distinct neutrophils that readily exited the circulation, resulting in neutropenia. PMID: 28553950
  5. DARC/CD234 is expressed on macrophages and stabilizes CD82 on long-term repopulating hematopoietic stem cells, promoting their quiescence. PMID: 26996598
  6. Ackr1 deficiency appears to be protective in the ApoE knockout model of atherogenesis, but it is associated with only minor changes in cytokine and chemokine expression, as well as T-cell subset frequency and inflammatory macrophage content. PMID: 25858253
  7. Our findings suggest that normal motor function and behavior may partially rely on the negative regulation of Purkinje cell activity by Ackr1. PMID: 24997773
  8. Darc plays a role in modulating the inflammatory response to bone injury, and the absence of Darc expression promotes cartilage formation in fracture calluses without affecting bony union or fracture healing at 21 days post-fracture. PMID: 24146983
  9. Our data revealed a role for erythrocyte DARC as a chemokine reservoir and that endothelial DARC contributes to the pathogenesis of experimental autoimmune encephalomyelitis by shuttling chemokines across the blood-brain barrier. PMID: 24625696
  10. DARC is crucial for chemokine-mediated leukocyte recruitment in vivo. PMID: 20061440
  11. Plasmodium yoelii utilizes the murine Duffy antigen receptor for chemokines as a receptor for normocyte invasion and an alternative receptor for reticulocyte invasion. PMID: 11929753
  12. Vascular endothelial cells may induce Duffy protein expression to regulate leukocyte and/or chemokine trafficking. PMID: 12697152
  13. The Duffy antigen and glycophorin A act as receptors for rodent malaria parasite invasion of erythrocytes. PMID: 15278442
  14. Our research has identified the binding domain on the mDuffy protein responsible for Plasmodium yoelii binding to erythrocytes. PMID: 16386320
  15. DARC functions to clear angiogenic CXC chemokines from the prostate tumor microcirculation. PMID: 16394268
  16. Darc negatively regulates bone mineral density (BMD) by increasing osteoclast formation. Darc is proposed as a candidate gene for chromosome 1 BMD QTL2. PMID: 17416748
  17. Our results indicate that endothelial cell overexpression of mDARC increased leukocyte trafficking to the tumor, reduced blood vessel growth into the tumor, and slowed the growth rate of melanoma. PMID: 17942909
  18. Loss of red cell chemokine scavenging promotes transfusion-related lung inflammation. PMID: 19064726
  19. Renal inflammation developed more rapidly in DARC-deficient mice, without affecting the extent of renal injury at later time points. PMID: 19498001
  20. DARC regulates lung inflammation by controlling the distribution and presentation of chemokines that bind CXCR2. PMID: 19499525

Show More

Hide All

Database Links

KEGG: mmu:13349

STRING: 10090.ENSMUSP00000045134

UniGene: Mm.6393

Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Subcellular Location
Early endosome. Recycling endosome. Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in liver and brain.

Q&A

What is mouse Duffy Antigen Receptor for Chemokines (Darc) and how does it differ from other chemokine receptors?

Mouse Darc is a unique chemokine receptor classified as a "silent receptor" because it can bind both CXC and CC chemokines and undergo ligand-induced receptor internalization, but lacks coupling to trimeric G proteins required for classic G protein-coupled receptor signaling . This fundamental difference distinguishes Darc from conventional chemokine receptors like CXCR2, which utilize G protein-dependent signaling pathways to mediate cellular responses. Structurally, mouse Darc contains a 62 amino acid N-terminal extracellular region and a 28 amino acid C-terminal cytoplasmic tail . Over its four extracellular domains (amino acids 1-62, 115-127, 186-205, 264-285), mouse Darc shares 52% amino acid identity with human Darc and 75% with rat Darc, indicating significant cross-species conservation but with notable structural differences .

How is Darc expression regulated in mouse tissues?

Darc expression shows tissue-specific patterns in mice, with significant expression observed in endothelial cells of post-capillary venules across various tissues . Immunohistochemical studies have demonstrated Darc localization in specific structures like hair follicles in mouse skin . Expression analysis comparing different mouse strains has revealed strain-specific variations in Darc expression levels. For instance, studies between B6 and CAST mice identified 28 polymorphisms distinguishing the Darc gene between these strains, including three SNPs in the promoter region, 15 in intervening sequences, and 10 in the coding region . These polymorphisms appear to affect Darc expression and function, though interestingly, none of the promoter polymorphisms covered consensus sequences known to regulate transcription processes. This suggests that the observed expression differences between strains may be attributable to SNPs in the coding region rather than transcriptional regulation .

What are the key mouse models available for studying Darc function?

Several important mouse models have been developed to investigate Darc function in vivo. The most straightforward is the Darc-knockout (Darc-KO) model, generated on a B6 background, which has been particularly valuable for bone metabolism studies . Congenic mouse lines have also been created through repeated backcrossing of CAST with B6 mice to study bone mineral density (BMD) quantitative trait loci (QTL) associated with Darc . More specialized models include transgenic mice where the preproendothelin promoter/enhancer (PPEP) drives expression of murine Darc specifically in endothelial cells (PPEP-mDARC mice) . This model was developed through a process where 1.5 kb of genomic DNA encoding murine Duffy was ligated to human growth hormone polyadenylation sequence and then ligated into a vector containing the PPEP. The linearized DNA was microinjected into fertilized ova from C57Bl/6 female mice and transferred into pseudopregnant female B6D2 F1 foster mothers . Parallel models featuring CXCR2 overexpression (PPEP-mCXCR2 mice) have allowed for comparative studies revealing opposing roles of these receptors in tumor angiogenesis and growth .

How can researchers effectively identify and validate Darc expression in experimental samples?

Researchers can employ multiple complementary approaches to identify and validate Darc expression in experimental samples. Western blot analysis using validated antibodies such as Sheep Anti-Mouse/Rat DARC Antigen Affinity-purified Polyclonal Antibody can detect Darc as a specific band at approximately 40 kDa in tissues like mouse and rat liver . Immunohistochemistry and immunofluorescence techniques are effective for visualizing Darc localization in tissue sections, with studies showing specific staining in structures like hair follicles when using anti-Darc antibodies at concentrations of 0.5 μg/mL . For gene expression analysis, quantitative PCR remains valuable, as demonstrated in studies comparing Darc expression levels between different mouse strains . When using these methods, appropriate controls are essential - researchers should include both positive controls (tissues known to express Darc) and negative controls (tissues from Darc-KO mice) to validate signal specificity. Expression data should be normalized to reliable housekeeping genes, and when possible, correlation between protein and mRNA levels should be established to account for post-transcriptional regulation.

How does Darc regulate bone mineral density, and what experimental approaches best demonstrate this relationship?

Darc functions as a negative regulator of bone mineral density (BMD) by increasing osteoclast formation, as demonstrated through multiple complementary experimental approaches . The initial identification of Darc as a BMD quantitative trait locus (QTL) gene involved a methodical process combining: (1) genetic mapping with polymorphic markers, (2) generation and phenotypic characterization of congenic mouse sublines, (3) expression profiling of genes in the QTL region, and (4) SNP analyses . The functional relationship between Darc and BMD was conclusively demonstrated through skeletal phenotyping of Darc-knockout mice, which showed significantly increased femur volumetric BMD compared to wild-type mice despite similar body weight and femur length .

The mechanistic basis of this relationship was elucidated through in vitro osteoclast formation assays, which showed reduced formation of TRAP-positive multinucleated cells in nonadherent bone marrow cultures from both Darc-knockout mice and congenic mice compared to B6 controls . This finding was further validated by the observation that treatment with Darc-antibody in the presence of Tnfsf11 and Csf1 significantly reduced osteoclast formation . In vivo histomorphometry studies provided additional supporting evidence, revealing that TRAP-positive bone resorbing surface was significantly reduced at both the endosteum (47%, P = 0.002) and periosteum (8%, P = 0.02) of femurs from Darc-KO mice compared to controls, while bone formation rates remained unchanged .

What are the critical methodological considerations when studying Darc-mediated osteoclast formation?

When investigating Darc's role in osteoclast formation, several methodological considerations are critical for robust and reproducible results. First, researchers must carefully select the appropriate experimental model. While both in vitro nonadherent bone marrow cultures (NABMC) and in vivo histomorphometry provide valuable insights, they measure different aspects of Darc function . NABMCs evaluate direct effects on osteoclast formation capacity, whereas histomorphometry quantifies the net result of Darc's influence on bone remodeling dynamics .

For in vitro osteoclast formation assays, standardization of culture conditions is essential. Cultures should include Tnfsf11 and Csf1 at consistent concentrations to stimulate osteoclastogenesis, and TRAP staining should be performed according to validated protocols . When using Darc-antibody for inhibition studies, antibody specificity should be verified, and appropriate isotype controls included. Quantification of TRAP-positive multinucleated cells should follow consistent criteria for cell counting, with automated image analysis methods preferred to reduce observer bias .

For in vivo histomorphometry, consistent sectioning planes and standardized analysis regions are crucial for comparing different mouse genotypes. Both static parameters (osteoclast numbers, TRAP-positive surface) and dynamic parameters (bone formation rate) should be assessed to comprehensively evaluate Darc's effects on bone remodeling . Age and sex matching between experimental groups is particularly important given the significant effects of these variables on bone metabolism.

How do DARC and CXCR2 differentially influence tumor angiogenesis and growth?

DARC and CXCR2 exhibit opposing roles in tumor angiogenesis and growth, providing a fascinating paradigm for chemokine receptor function in cancer biology . Research using transgenic mouse models with endothelial cell-specific expression of either murine DARC (PPEP-mDARC) or murine CXCR2 (PPEP-mCXCR2) has demonstrated these contrasting functions in melanoma tumor xenografts . When immortalized murine melanocytes overexpressing macrophage inflammatory protein-2 were injected subcutaneously, tumor growth was significantly inhibited in PPEP-mDARC mice but enhanced in PPEP-mCXCR2 mice compared to control animals .

This differential effect appears to be mediated through multiple mechanisms. First, tumor-associated angiogenesis was markedly reduced in mDARC transgenic mice but significantly increased in mCXCR2 transgenic mice . This supports the hypothesis that DARC competes with CXCR2 for angiogenic chemokine ligands, thereby inhibiting the pro-angiogenic signaling mediated by CXCR2. Second, tumors in mDARC transgenic mice exhibited substantially higher infiltration of leukocytes, particularly CD4+ and CD8+ T lymphocytes and macrophages, suggesting that DARC expressed on endothelial cells facilitates leukocyte migration into the tumor microenvironment . This enhanced immune cell recruitment likely contributes to tumor growth inhibition through immunological mechanisms. Third, specialized vessel structures visualized by PAS staining (possibly representing vasculogenic mimicry channels) were more prevalent in mCXCR2 transgenic mouse tumors, potentially providing an alternative source of nutrition to further enhance tumor growth .

What experimental approaches can researchers use to study DARC's role in leukocyte trafficking to tumors?

Investigating DARC's role in leukocyte trafficking to tumors requires a multi-faceted experimental approach combining in vivo, ex vivo, and in vitro methods. From the search results, several effective strategies emerge:

  • Flow cytometry analysis of tumor-infiltrating lymphocytes: Single-cell suspensions from tumors can be analyzed using antibodies against specific lymphocyte markers (CD4, CD8, CD22) to quantify different immune cell populations, as demonstrated in studies comparing tumors from mDARC transgenic mice with wild-type controls .

  • Immunohistochemical analysis of tumor sections: Using pan-lymphocyte antibody cocktails (CD3/CD45) allows visualization and quantification of total lymphocyte density within tumors . This approach is particularly valuable for assessing spatial distribution of immune cells within the tumor microenvironment.

  • Transendothelial cell migration assays: These in vitro assays can directly test DARC's role in facilitating leukocyte migration across endothelial barriers in response to specific chemokines . Using endothelial cell monolayers that either express or lack DARC allows for controlled assessment of its contribution to migration efficiency.

  • Transgenic mouse models with cell-type specific DARC expression: As exemplified by the PPEP-mDARC mice, transgenic models that selectively express DARC in endothelial cells provide powerful tools for investigating its role in leukocyte recruitment in vivo .

  • Intravital microscopy: Though not mentioned in the search results, this technique allows real-time visualization of leukocyte-endothelial interactions and could provide dynamic insights into how DARC influences various stages of leukocyte recruitment (rolling, adhesion, transmigration) in tumor vasculature.

What are the key structural domains of mouse Darc and how do they influence function?

Mouse Darc exhibits a complex structure with distinct domains that directly influence its functional properties. The protein contains four critical extracellular domains (amino acids 1-62, 115-127, 186-205, and 264-285) that are involved in chemokine binding and recognition . The 62 amino acid N-terminal extracellular region is particularly important for ligand binding interactions, while the 28 amino acid C-terminal cytoplasmic tail likely plays a role in the protein's trafficking and cellular localization despite lacking conventional signaling motifs found in G protein-coupled receptors .

Comparative analysis reveals that mouse Darc shares 52% amino acid identity with human Darc and 75% with rat Darc across these extracellular domains, indicating evolutionary conservation of critical functional regions while allowing for species-specific adaptation . Genetic studies between mouse strains have identified significant polymorphisms that affect function - for example, analysis between B6 and CAST mice revealed 28 polymorphisms, with 6 in the coding region leading to amino acid changes . These amino acid variations appear to directly impact chemokine binding affinity, as demonstrated by reduced binding of several chemokines to Darc from congenic mice compared to B6 mice .

The functional significance of these structural elements is further evidenced by antibody studies - antibodies targeting specific epitopes within Darc can block its function, as shown by the inhibition of multinucleated osteoclast formation when Darc-antibody was applied in the presence of Tnfsf11 and Csf1 . This suggests that certain structural domains are critical for Darc's role in cell trafficking processes required for osteoclast precursor fusion.

How do strain-specific polymorphisms in mouse Darc influence experimental outcomes?

Strain-specific polymorphisms in mouse Darc significantly impact experimental outcomes, creating a complex landscape that researchers must navigate carefully. Comprehensive analysis has identified 28 polymorphisms that distinguish the Darc gene in B6 mice from the CAST strain, distributed across promoter regions (3 SNPs), intervening sequences (15 polymorphisms), and coding regions (10 polymorphisms, with 6 leading to amino acid changes) . These genetic variations have profound functional consequences that directly influence experimental results.

The most significant impact appears to be on Darc's chemokine binding properties. Reduced binding of several chemokines to Darc from congenic mice carrying CAST-derived Darc compared to B6 mice has been observed . This altered binding affinity directly affects downstream biological processes, as evidenced by:

  • Differential bone mineral density (BMD) between strains: Congenic sublines of mice carrying small chromosomal segments from CAST BMD QTL show greater femur BMD than B6 mice, phenocopying the effects seen in Darc-knockout mice .

  • Altered osteoclast formation capacity: Nonadherent bone marrow cultures from congenic mice show 70% decreased formation of TRAP-positive multinucleated cells compared to B6 control mice despite increased Darc gene expression .

  • Changes in protein function feedback: The loss of protein function caused by amino acid changes in the chemokine binding pocket may paradoxically lead to increased gene expression due to loss of negative feedback mechanisms .

These strain-dependent variations necessitate careful consideration of genetic background in experimental design. Researchers should explicitly report the mouse strain used, consider using multiple strains to validate findings, and be cautious when comparing results across studies using different genetic backgrounds. The use of genetically matched controls is essential, particularly in studies involving bone metabolism or inflammatory responses where Darc function plays a significant role.

What are the optimal approaches for producing and validating recombinant mouse Darc for research applications?

Producing and validating recombinant mouse Darc for research applications requires careful attention to several critical factors. Based on available research methodologies, the following approaches represent current best practices:

For recombinant production, E. coli expression systems have been successfully employed to generate specific domains of mouse Darc, particularly the extracellular regions (Met1-Pro61, Ala115-Cys127, Ser186-Lys205, Tyr264-Asn285) . When designing expression constructs, researchers should consider the inclusion of affinity tags (His-tag, GST) that facilitate purification while minimizing interference with protein folding and function. Expression of full-length Darc, with its transmembrane domains, may require eukaryotic expression systems to ensure proper folding and post-translational modifications.

Validation of recombinant Darc should employ multiple complementary approaches:

  • Structural validation: SDS-PAGE and mass spectrometry can confirm protein size and purity, with recombinant mouse Darc typically detected at approximately 40 kDa .

  • Immunological validation: Western blot analysis using validated antibodies against mouse Darc can verify protein identity. The use of Darc-knockout mouse tissues as negative controls strengthens validation rigor .

  • Functional validation: Chemokine binding assays are essential to confirm that recombinant Darc retains its ligand-binding properties. Competitive binding assays with known Darc ligands (CCL2, CCL5) can quantitatively assess binding affinity .

  • Application-specific validation: For antibody production applications, the recombinant protein should be tested for immunogenicity and the resulting antibodies characterized for specificity in multiple applications (Western blot, immunohistochemistry, flow cytometry) .

How can researchers effectively design experiments to investigate the interaction between Darc and specific chemokines?

Designing experiments to investigate Darc-chemokine interactions requires careful consideration of both technical aspects and biological context. Based on published methodologies, several approaches are particularly effective:

For in vitro binding studies, solid-phase binding assays using immobilized recombinant Darc and labeled chemokines can provide quantitative measures of binding affinity and specificity . Competitive binding assays with multiple chemokines can reveal hierarchies of binding preference and potential site sharing between different ligands. Surface plasmon resonance (SPR) or fluorescence anisotropy can provide real-time kinetic information on association and dissociation rates.

Cellular assays offer more physiologically relevant contexts for studying these interactions. Transfected cell lines expressing wild-type or mutant forms of mouse Darc can be used to assess how specific amino acid changes affect chemokine binding and receptor internalization . Flow cytometry with fluorescently-labeled chemokines can quantify binding to Darc-expressing cells, while immunofluorescence microscopy can visualize receptor-ligand co-localization and trafficking.

Functional readouts are essential for understanding the biological significance of Darc-chemokine interactions. Since Darc has been implicated in cell trafficking processes, transendothelial migration assays using endothelial monolayers expressing or lacking Darc can directly assess how specific chemokine interactions influence leukocyte movement . For bone metabolism applications, osteoclast formation assays using bone marrow cultures in the presence of specific chemokines, with or without Darc-blocking antibodies, can reveal which chemokine interactions are functionally relevant .

Genetic approaches provide powerful tools for dissecting interaction specificity in vivo. Comparing phenotypes of Darc-knockout mice challenged with different chemokines or using conditional Darc knockouts in specific cell types can reveal tissue-specific roles of particular Darc-chemokine interactions . Site-directed mutagenesis of specific amino acid residues can create Darc variants with altered binding profiles for structure-function studies.

What are common challenges in Darc expression analysis and how can they be overcome?

Researchers frequently encounter several challenges when analyzing Darc expression, each requiring specific technical solutions:

Challenge 1: Low signal-to-noise ratio in Darc detection
Western blot detection of Darc often faces challenges related to antibody specificity and protein abundance. To overcome this, researchers should optimize antibody concentration (typically starting at 1 μg/mL for Western blot applications) , employ enhanced chemiluminescence detection methods, and consider sample enrichment through immunoprecipitation for tissues with low expression levels. Including positive controls (tissues known to express Darc) and negative controls (tissues from Darc-KO mice) is essential for validating signal specificity .

Challenge 2: Variable Darc expression across tissues and experimental conditions
Darc expression shows significant tissue-specific variation and can be influenced by experimental conditions. Researchers should first validate reference genes for qPCR normalization specifically for each tissue type being studied. When comparing expression between experimental groups, matched sampling (time of day, age, sex) is crucial to minimize biological variation . For immunohistochemical detection, protocol optimization should be performed for each tissue type, with antibody concentration typically around 0.5 μg/mL for frozen sections .

Challenge 3: Discrepancies between mRNA and protein expression levels
Post-transcriptional regulation can lead to poor correlation between Darc mRNA and protein levels. To address this complexity, researchers should analyze both transcript and protein levels in parallel, consider analyzing multiple time points to capture expression dynamics, and investigate potential regulatory mechanisms (microRNAs, RNA-binding proteins) that might explain discrepancies .

Challenge 4: Strain-specific polymorphisms affecting detection
The 28 polymorphisms identified between B6 and CAST mice can affect probe binding in expression analysis . Researchers should design PCR primers and probes that target conserved regions across strains, sequence verify the Darc locus in new or uncommon strains before expression analysis, and consider using multiple detection methods (antibodies recognizing different epitopes) to confirm expression patterns.

What are the key considerations when interpreting seemingly contradictory results in Darc functional studies?

When confronted with apparently contradictory results in Darc functional studies, researchers should systematically evaluate several factors that might explain the discrepancies:

Genetic background effects: The 28 polymorphisms identified between mouse strains significantly impact Darc function . Careful documentation of the precise genetic background used in each study is essential, as congenic strains might retain unintended genomic regions that affect the phenotype. Backcrossing strategies should be thoroughly described, and key findings should be validated across multiple genetic backgrounds when possible.

Compensatory mechanisms in knockout models: Darc-knockout mice may develop compensatory mechanisms that mask or alter the expected phenotype. Studies have demonstrated paradoxical findings where increased Darc gene expression in congenic mice coincides with reduced osteoclast formation , suggesting complex regulatory relationships. Time-course studies and inducible knockout systems can help distinguish direct Darc effects from compensatory adaptations.

Technical variations in functional assays: Methodological differences can significantly impact results. For example, in osteoclast formation assays, variations in culture conditions, cell isolation procedures, or quantification methods can lead to different outcomes . Detailed reporting of experimental protocols, reagent sources, and quantification parameters is essential for meaningful cross-study comparisons.

Ligand-specific effects: Darc interacts with multiple chemokines, and different studies may inadvertently focus on different ligand interactions. The specific chemokines present or manipulated in an experimental system should be explicitly documented, as Darc may have ligand-specific effects that could explain seemingly contradictory outcomes across studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.