Recombinant Mouse Dynamin-like 120 kDa protein, mitochondrial (Opa1)

Shipped with Ice Packs
In Stock

Description

Structure and Protein Information

Mouse OPA1 is a dynamin-related GTPase encoded by the Opa1 gene (Gene ID: 74143) with UniProt accession number P58281 . The protein has an approximate molecular weight of 90-100 kDa when detected by immunoblot analysis . OPA1 is characterized by a bipartite mitochondrial targeting sequence that directs its import into mitochondria . During mitochondrial import, OPA1 undergoes proteolytic processing, resulting in multiple isoforms with distinct functional properties .

The protein exists in several forms within cells:

  1. Long forms (L-isoforms): Membrane-anchored forms that result from initial processing of the matrix-targeting signal

  2. Short forms (S-isoforms): Produced through further proteolytic processing of L-isoforms in the mitochondrial matrix

Importantly, the L-isoforms appear to be fusion-competent, while the S-isoforms alone cannot support mitochondrial fusion . This differential functionality highlights the importance of proteolytic processing in regulating OPA1 activity.

Localization and Topology

OPA1 is primarily localized to the mitochondria, specifically anchored to the inner mitochondrial membrane with its functional domains facing the intermembrane space . This precise localization is essential for its role in maintaining mitochondrial cristae structure and facilitating inner membrane fusion events. Electron microscopy studies have confirmed OPA1's positioning close to the cristae structures , supporting its role in maintaining their architecture.

Role in Mitochondrial Fusion and Morphology

OPA1 plays a critical role in regulating mitochondrial dynamics, particularly inner membrane fusion processes. Numerous studies in mice have demonstrated OPA1's essential function in maintaining mitochondrial network morphology . The protein works in concert with other mitochondrial dynamics proteins to balance fusion and fission events, which are crucial for mitochondrial quality control and cellular adaptation to metabolic demands.

The fusion activity of OPA1 appears to be primarily mediated by the membrane-anchored L-isoforms, as knockdown of OPA1 induces mitochondrial fragmentation that can be rescued by expression of L-isoforms but not S-isoforms . This finding underscores the importance of properly regulated OPA1 processing in maintaining mitochondrial network integrity.

Cristae Morphogenesis and Mitochondrial Function

Beyond its role in fusion, OPA1 is indispensable for proper cristae morphogenesis and organization . Cristae are specialized inner membrane structures that house the respiratory complexes necessary for oxidative phosphorylation. Proper cristae architecture, maintained in part by OPA1, is essential for optimal mitochondrial respiratory function.

Intriguingly, tissue-specific roles of OPA1 have been observed. Analysis of OPA1 liver knockout (LKO) mice revealed that despite disrupted cristae morphology, these mice maintained normal mitochondrial respiration and were generally healthy . This finding suggests that OPA1's importance may vary across different tissues, with compensatory mechanisms potentially operating in the liver to maintain function in the absence of OPA1.

OPA1 Processing in Health and Disease

The proteolytic processing of OPA1 is regulated by various factors including mitochondrial membrane potential, expression of proteases like m-AAA protease paraplegin, and apoptotic signaling . These regulatory mechanisms allow the cell to modulate mitochondrial dynamics in response to changing physiological conditions.

Recent studies with mouse models expressing either cleavable or non-cleavable OPA1 isoforms have provided insights into the physiological significance of OPA1 processing. Remarkably, expression of a single cleavable or non-cleavable OPA1 isoform is sufficient to preserve embryonic development and support normal adult mouse health . This finding indicates that while OPA1 itself is essential, the diversity of its processed forms may be dispensable under normal conditions.

Production and Characteristics of Recombinant OPA1

Recombinant mouse OPA1 protein has been successfully produced for research purposes and appears on immunoblots with an approximate molecular weight of 100 kDa . This recombinant form serves as a valuable tool for investigating OPA1's structure-function relationships and for developing detection methods.

When using recombinant OPA1 protein in experimental settings, researchers should consider the potential differences between recombinant and native forms, particularly regarding post-translational modifications and processing events that might affect the protein's functionality.

Detection and Quantification Methods

Several approaches are available for detecting and quantifying mouse OPA1:

ELISA Kit: Commercially available sandwich ELISA kits enable in vitro quantitative measurement of mouse OPA1 concentrations in various biological samples, including tissue homogenates, cell lysates, and cell culture supernatants . These kits typically offer:

ParameterSpecification
Test Range0.156 ng/ml - 10 ng/ml
Sensitivity< 0.06 ng/ml
FormLyophilized
Detection MethodColorimetric
Sample TypesTissue homogenates, cell lysates, cell culture supernatants, other biological fluids
Storage4°C during shipping; specific storage according to kit manual
ValidityAt least 6 months, up to 12 months

Immunoblotting: Antibodies against mouse OPA1 are available for western blot analysis. For example, the mouse monoclonal antibody clone 1B2D8 has been validated for detection of OPA1 in mouse, human, porcine, and rat samples . When analyzing mouse tissue samples by immunoblot, OPA1 typically appears as two major bands with approximate molecular weights of 90 and 80 kDa, representing the long and short isoforms resulting from proteolytic processing .

Relevance to Human Disease

OPA1 mutations in humans are associated with autosomal dominant optic atrophy, a condition characterized by degeneration of retinal ganglion cells and the optic nerve . Studies in mouse models have helped elucidate the mechanisms underlying this disease by characterizing OPA1's expression and function in the retina and optic nerve.

Immunoblot analysis of rat retina and optic nerve has revealed OPA1 expression patterns similar to those in other tissues, with two major bands of approximately 90 and 80 kDa . This research helps bridge the gap between molecular mechanisms and clinical manifestations of OPA1-related disorders.

Protective Functions in Stress Conditions

Beyond its basic roles in mitochondrial dynamics, OPA1 appears to have protective functions under certain stress conditions. For example, OPA1 liver knockout has been found to protect against drug toxicity by decreasing toxic drug metabolism and conferring resistance to mitochondrial permeability transition . This finding suggests potential therapeutic applications for targeting OPA1 in certain liver conditions.

Additionally, OPA1 processing has been found to prolong life span and protect against mitochondrial cardiomyopathy in OXPHOS-deficient mice . Understanding these protective mechanisms could inform the development of therapies for mitochondrial disorders.

Future Directions in OPA1 Research

Current research on recombinant mouse OPA1 protein opens several promising avenues for future investigation:

  1. Further characterization of the specific roles of different OPA1 isoforms and their processed forms

  2. Development of more sensitive and specific detection methods for both native and recombinant OPA1

  3. Exploration of tissue-specific functions and compensatory mechanisms in OPA1-deficient tissues

  4. Investigation of potential therapeutic applications targeting OPA1 processing or activity in mitochondrial diseases

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the protein at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you have a preferred tag type, please inform us, and we will endeavor to incorporate it preferentially.
Synonyms
Opa1; Dynamin-like 120 kDa protein, mitochondrial; Large GTP-binding protein; LargeG; Optic atrophy protein 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
195-960
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Opa1
Target Protein Sequence
ATDHGSESDKHYRKVSDKEKIDQLQEELLHTQLKYQRILERLEKENKELRKLVLQKDDKG IHHRKLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIF PRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEG CTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIIL CIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMK ALGYFAVVTGKGNSSESIEAIREYEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWK MVRESVEQQADSFKATRFNLETEWKNNYPRLRELDRNELFEKAKNEILDEVISLSQVTPK HWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAW ETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRS ISDKQQWDAAIYFMEEALQGRLKDTENAIENMIGPDWKKRWMYWKNRTQEQCVHNETKNE LEKMLKVNDEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQVYRRHFLKTALNHCN LCRRGFYYYQRHFIDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVL EDFAEDGEKKVKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK
Uniprot No.

Target Background

Function
OPA1, a Dynamin-related GTPase, is crucial for maintaining normal mitochondrial morphology by regulating the balance between mitochondrial fusion and fission. Optimal activity in promoting mitochondrial fusion requires coexpression of isoform 1 with shorter alternative products. It binds to lipid membranes enriched in negatively charged phospholipids, such as cardiolipin, and facilitates membrane tubulation. While its intrinsic GTPase activity is low, it significantly increases upon interaction with lipid membranes. OPA1 plays a role in cristae remodeling and the release of cytochrome c during apoptosis. Proteolytic processing in response to intrinsic apoptotic signals can lead to the disassembly of OPA1 oligomers and the release of the caspase activator cytochrome C (CYCS) into the mitochondrial intermembrane space. It contributes to mitochondrial genome maintenance. Following stress conditions that induce loss of mitochondrial membrane potential, cleavage at position S1 by OMA1 occurs, resulting in negative regulation of mitochondrial fusion. Isoforms that contain the alternative exon 4b (present in isoform 2, but not in isoform 1) are essential for mitochondrial genome maintenance, likely by anchoring the mitochondrial nucleoids to the inner mitochondrial membrane.
Gene References Into Functions
  1. Proposes a novel function of OPA1 in mediating the CoQ10-responsive regulation of respiratory CIV activity in brain mitochondria from aging mice. PMID: 28890359
  2. Multiple OPA1 isoforms are required for mitochondrial dynamics, while any single isoform can support all other functions. PMID: 28636943
  3. Mechanistically, the ablation of Opa1 leads to ER stress, which signals via the unfolded protein response (UPR) and FoxOs, inducing a catabolic program of muscle loss and systemic aging. PMID: 28552492
  4. Mitochondrial dysfunction in an Opa1 mouse model of dominant optic atrophy results from Opa1 haploinsufficiency. PMID: 27468686
  5. TNFR2 activation protects cardiac myocytes against stress by up-regulating OPA1 expression. PMID: 28637784
  6. OPA1 mutant mice are resistant to age- and diet-induced weight gain and insulin resistance, by mechanisms that involve activation of endoplasmic reticulum stress and secretion of fibroblast growth factor 21 (FGF21) from skeletal muscle, resulting in increased metabolic rates and improved whole-body insulin sensitivity. PMID: 28607005
  7. OPA1 modulates cristae morphology but is dispensable for cristae junction formation. Endogenous OPA1 and MIC60 show a physical interaction. PMID: 27587279
  8. Opa1 deficiency was associated with increased sensitivity to Ischemia-Reperfusion Injuries, imbalance in dynamic mitochondrial Ca2+ uptake, and subsequent increase in NCX activity. PMID: 27723783
  9. Whereas Parkin has been reported to positively regulate the expression of OPA1 through NEMO, herein we found that PARK2 overexpression did not modify the expression of OPA1. PMID: 26024391
  10. Stress-induced OMA1 activation and guanosine triphosphatase OPA1 cleavage limit mitochondrial fusion and promote neuronal death. PMID: 26783299
  11. Data suggest that in a mouse model of neonatal hypoxic-ischemic brain injury, the expression of mitochondrial shaping proteins, such as OPA1 and Yme1L, are altered; in vitro and in vivo, OPA1 is cleaved to shorter forms and Yme1L expression is reduced. PMID: 26393574
  12. Results indicate that the OPA1-dependent cristae remodeling pathway is a fundamental, targetable determinant of tissue damage in vivo. PMID: 26039448
  13. Cristae shape amelioration by controlled Opa1 overexpression improves two mouse models of mitochondrial disease. PMID: 26039449
  14. Unprocessed OPA1 is sufficient to maintain heart function, OMA1 is a critical regulator of cardiomyocyte survival, and mitochondrial morphology and cardiac metabolism are intimately linked. PMID: 26785494
  15. Data suggest that mitochondrial fusion and fission events are regulated by four GTPases: OPA1, Drp1 (dynamin 1-like protein), and Mfn1/2 (mitofusin 1 and 2). [REVIEW] PMID: 26375863
  16. Photoresponsive RGCs are protected against cell death due to the Opa1 mutation, but not by melanopsin expression itself. PMID: 26218912
  17. Results suggest that Mfn2 and OPA1 are upregulated during bone marrow progenitor differentiation and promote the migration of immature dendritic cells by regulating the expression of CCR7. PMID: 25387754
  18. Reactive oxygen species might affect MyHC content by modulating OPA1 cleavage in muscle degeneration. PMID: 25393477
  19. Mitochondria adapt to metabolic shifts through the parallel remodeling of the cristae and of the MERCs via a mechanism that degrades Opa1 in an Mfn2-dependent pathway. PMID: 25352671
  20. A novel way in which OPA1 senses energy substrate availability, which modulates its function in the regulation of mitochondrial architecture in a SLC25A protein-dependent manner. PMID: 25298396
  21. Proteolytic cleavage of Opa1 stimulates mitochondrial inner membrane fusion and couples fusion to oxidative phosphorylation. PMID: 24703695
  22. OPA1 appears necessary for the normal adaptive response and mitochondrial biogenesis of skeletal muscle to training. PMID: 24042504
  23. OMA1-mediated OPA1 proteolysis plays an important role in the disruption of mitochondrial dynamics in ischemic acute kidney injury. PMID: 24671334
  24. Findings show that transient matrix contraction is a novel cellular mechanism regulating mitochondrial activity through the function of the inner membrane dynamin OPA1. PMID: 24627489
  25. Constitutive OPA1 cleavage by YME1L and OMA1 at two distinct sites leads to the accumulation of both long and short forms of OPA1 and maintains mitochondrial fusion. PMID: 24616225
  26. OPA1 mutation leads to deficiency in antioxidant transcripts, increased reactive oxygen species, mitochondrial dysfunction, and late-onset cardiomyopathy. PMID: 23316298
  27. The OPA1/PARL dependent pathway of cristae remodeling is implicated in heat shock. PMID: 22579715
  28. Opa1-dependent inner membrane remodeling controls efficiency of steroidogenesis. PMID: 22658590
  29. OPA1 plays an important role in mitochondrial morphology and mitochondrial permeability transition pore functioning. PMID: 22406748
  30. This study showed that mitochondrial fission protein dynamin-related protein 1 (Drp1) and fusion protein optic atrophy 1 (Opa1) were both upregulated in the ischemic penumbra. PMID: 22345048
  31. Opa1 is essential for retinal ganglion cell synaptic architecture and connectivity. PMID: 22300878
  32. Optic atrophy 1 is an A-kinase anchoring protein on lipid droplets that mediates adrenergic control of lipolysis. PMID: 21983901
  33. Beta cells lacking Opa1 maintained normal copy numbers of mtDNA; however, the amount and activity of electron transport chain complex IV were significantly decreased. PMID: 21551073
  34. This study provides the first evidence that homocysteine-induced ganglion cell loss involves the dysregulation of mitochondrial dynamics, both in vivo and in vitro. PMID: 21642619
  35. OPA1 as a potential therapeutic target to promote neuronal survival following acute brain damage and neurodegenerative diseases. PMID: 21041314
  36. Mitochondrial retention of Opa1 protein is essential for normal embryogenesis. PMID: 20652258
  37. OPA1 can directly modulate retinal ganglion cell survival, and increasing OPA1 expression may protect against retinal ganglion cell death in glaucomatous optic neuropathy. PMID: 20664796
  38. These results highlight the importance of normal mitochondrial fusion balance, as influenced by the OPA1 protein in maintaining the dendritic morphology of retinal ganglion cells. PMID: 20817698
  39. OPA1 disease alleles associated with dominant optic atrophy display selective defects in several activities, including cardiolipin association, GTP hydrolysis and membrane tubulation. PMID: 20185555
  40. Our results indicate an important role of OPA1 in mitochondrial dependent Ca(2+) homeostasis and cell survival in retinal ganglion cells. PMID: 20450306
  41. A direct effect of loss of Omi/HtrA2 on mitochondrial morphology and a novel role of this mitochondrial serine protease in the modulation of OPA1. PMID: 20064504
  42. This is the first electrophysiological demonstration of a visual function deficit in aged Opa1 mice. VEP measurements and retrograde labeling experiments show that the number of RGCs is reduced whereas the remaining RGCs and axons function normally. PMID: 19834041
  43. Double Mfn-null cells show neither outer nor inner membrane fusion, while mitochondria in OPA1-null cells contain multiple matrix compartments bounded together by a single outer membrane, consistent with uncoupling of outer versus inner membrane fusion. PMID: 19477917
  44. The data suggest an important and specific function of the OPA1 protein, not only in the optic nerve forming ganglion cells but also in the intrinsic signal processing of the inner retina. PMID: 15505078
  45. OPA1 functionally requires mitofusin 1 to regulate mitochondrial fusion. PMID: 15509649
  46. OPA1, Mfn1 and Mfn2 have roles in mitochondrial fusion, cell growth, mitochondrial membrane potential, and cellular respiration. PMID: 15899901
  47. Thus, OPA1 has genetically and molecularly distinct functions in mitochondrial fusion and in cristae remodeling during apoptosis. PMID: 16839885
  48. Mitochondrial fragmentation correlates with processing of large isoforms of OPA1. PMID: 17003040
  49. Manipulation of OPA1 isoform 1 levels in induces changes in the mitochondrial network in the cell; mutations of isoform 1 could lead to devastating effects on retinal ganglion cells. PMID: 18419770
  50. IOP elevation may directly damage mitochondria in the ONH axons by promoting reduction of COX, mitochondrial fission and cristae depletion, alterations of OPA1 and Dnm1 expression, and induction of OPA1 release. PMID: 18469184

Show More

Hide All

Database Links
Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion. Mitochondrion membrane.
Tissue Specificity
Detected in brain (at protein level). Detected in brain, brain stem, heart, kidney, liver and skeletal muscle.

Q&A

What is the basic structure and function of mouse Opa1?

Mouse Opa1 shares 88% nucleotide identity and 97% amino acid identity with its human counterpart . It functions as a dynamin-related GTPase required for mitochondrial fusion and regulation of apoptosis. Opa1 exists in two main forms: as a single-pass membrane protein in the inner mitochondrial membrane and as soluble forms in the intermembrane space of mitochondria . It is expressed in multiple tissues including retina, brain, testis, heart, and skeletal muscles. Functionally, Opa1 regulates mitochondrial cristae structure and contributes to ATP synthesis while playing a crucial role in apoptotic pathways .

How are the various isoforms of mouse Opa1 generated?

Mouse Opa1, like human OPA1, undergoes alternative splicing to generate multiple transcript variants encoding different isoforms . Additionally, post-translational proteolytic processing contributes to Opa1 diversity. Opa1 exists in long forms (L-OPA1) and short forms (S-OPA1), with the latter resulting from proteolytic cleavage by mitochondrial proteases such as OMA1 and YME1L . This proteolytic processing is responsive to cellular stress signals and plays a significant role in regulating mitochondrial dynamics and apoptotic pathways. The balance between these forms is physiologically important, as L-OPA1 is fusion-competent while S-OPA1 is not .

What antibodies are recommended for detecting mouse Opa1 in experimental settings?

For effective detection of mouse Opa1, researchers have several validated antibody options. Commercially available antibodies that recognize mouse Opa1 include those that detect both long and short forms. For Western blot applications, antibodies can be used at concentrations of 0.2-1 μg/mL, yielding specific bands at approximately 80-100 kDa . When selecting an antibody, consider those raised against recombinant fragments of Opa1, such as those derived from amino acids D296-Q562 of the human protein, which show cross-reactivity with mouse Opa1 . For immunofluorescence on FFPE samples, a concentration of approximately 5 μg/mL is recommended, while flow cytometry applications typically require 1-3 μg per million cells .

What mouse models are available for studying Opa1 function and related diseases?

One well-characterized model is the heterozygous Opa1 Q285STOP mouse, which carries a defective allele with a stop codon at residue 285 in the GTPase domain, mimicking human pathological mutations associated with DOA . This model demonstrates decreased levels of wild-type Opa1 protein without expressing the truncated form. Another relevant model considered but ruled out as an Opa1 model is the Bst (belly spot and tail) mutant mouse, which shows optic nerve atrophy but does not carry mutations in the Opa1 gene . For studying specific aspects of Opa1 function, researchers have also developed cellular models with inducible expression systems, such as HeLa cell lines with doxycycline-inducible expression of truncated Opa1 variants .

How can researchers effectively isolate and maintain primary cells from Opa1 mutant mice?

When isolating mouse embryonic fibroblasts (MEFs) from Opa1 mutant mice such as the Opa1 Q285STOP model, standard isolation protocols can be applied, but researchers should be aware of potential mitochondrial phenotypes that may affect cell viability and growth. These cells typically exhibit mitochondrial respiratory deficiency and selective loss of respiratory Complex IV subunits . Importantly, this respiratory deficiency tends to increase as cells are passaged, suggesting that experimental designs should control for passage number when making comparisons. For optimal maintenance, culture these cells in appropriate media that supports mitochondrial function, and consider supplementation strategies if severe deficiencies are observed. When studying cellular responses to stress, be aware that Opa1 mutant cells may show differential sensitivity to various apoptotic stimuli - for instance, Opa1 Q285STOP MEFs demonstrate relative resistance to ER stress-induced apoptosis while showing normal or increased sensitivity to other apoptotic triggers .

What are the advantages of using Drosophila models for studying Opa1 function compared to mouse models?

Drosophila models offer several advantages for studying Opa1 function, particularly for investigating disease-causing variants. In a Drosophila model of autosomal dominant optic atrophy, researchers have been able to provide direct evidence for a dominant-negative mechanism of action for specific OPA1 mutations affecting the GTPase domain . These mutations are associated with more severe optic atrophy and additional neurological conditions such as sensorineural hearing loss (DOA plus syndrome). The Drosophila model enables measurement of axonal degeneration as an indicator of optic atrophy, providing a clinically relevant metric. The genetic tractability of Drosophila allows expression of human OPA1 variants in various genetic backgrounds, facilitating mechanistic studies that would be more challenging or time-consuming in mouse models . Additionally, the shorter generation time and lower maintenance costs of Drosophila make them suitable for initial screening of multiple variants before proceeding to more resource-intensive mouse studies.

What are the most reliable methods for assessing mitochondrial fusion defects in Opa1-deficient cells?

To assess mitochondrial fusion defects in Opa1-deficient cells, researchers can employ several complementary approaches. Fluorescence microscopy using mitochondrial markers such as MitoTracker or antibodies against mitochondrial proteins allows visualization of mitochondrial morphology, with fragmentation being characteristic of fusion defects. Live-cell imaging with photoactivatable fluorescent proteins targeted to mitochondria can directly measure fusion events over time. Electron microscopy provides higher-resolution analysis of mitochondrial ultrastructure, particularly cristae organization, which is regulated by Opa1. Functional assessments should include measurements of mitochondrial membrane potential using potentiometric dyes, respiratory capacity analysis using oxygen consumption rate measurements, and ATP synthesis capacity. Additionally, researchers should evaluate the balance between L-OPA1 and S-OPA1 forms using Western blot analysis, as this ratio is indicative of fusion competence . When comparing wild-type and Opa1-deficient cells, it's important to control for cell passage number, as mitochondrial defects in Opa1 mutant cells can progressively worsen with passaging .

How can researchers effectively distinguish between haploinsufficiency and dominant-negative effects in Opa1 mutation studies?

Distinguishing between haploinsufficiency and dominant-negative effects of Opa1 mutations requires several experimental approaches. One definitive strategy is to analyze the expression of the truncated protein using antibodies specific to the N-terminal region of Opa1. In the Opa1 Q285STOP mouse model, though the mutant transcript is present, the truncated protein is undetectable, supporting haploinsufficiency rather than a dominant-negative mechanism . To further confirm this, complementation experiments can be performed by expressing wild-type Opa1 in mutant cells - significant rescue of phenotypes would support haploinsufficiency. Conversely, expression of the mutant form in wild-type cells can reveal dominant-negative effects if it disrupts normal function.

For potentially dominant-negative mutations (particularly missense mutations in the GTPase domain), more definitive evidence can be obtained using animal models such as Drosophila, where expression of these variants in the presence of full human OPA1 complement can demonstrate interference with normal function . Quantitative analysis of mitochondrial phenotypes (fusion rates, cristae morphology, respiratory function) in these models can help determine the extent of dominant-negative effects. Additionally, biochemical assays assessing the interaction between wild-type and mutant Opa1 proteins can provide mechanistic insights into how dominant-negative effects might occur through protein-protein interactions.

What techniques provide the most accurate quantification of different Opa1 isoforms in experimental samples?

For accurate quantification of Opa1 isoforms, Western blotting with high-resolution gel systems remains the gold standard when performed with appropriate controls. When analyzing mouse samples, antibodies that can detect both long (L-OPA1) and short (S-OPA1) forms should be selected, such as those raised against N-terminal portions of Opa1 that would recognize all isoforms . To enhance separation of closely migrating isoforms, gradient gels (4-12% or 4-15%) are recommended. For more precise quantification, fluorescence-based Western blotting provides a wider linear range than chemiluminescence.

Alternative or complementary approaches include mass spectrometry-based proteomics, which can distinguish specific isoforms and post-translational modifications with high accuracy. Simple Western™ (automated capillary-based Western blotting) has also been validated for Opa1 detection, showing specific bands at approximately 90-96 kDa . For analysis of transcript variants, quantitative RT-PCR with isoform-specific primers can be employed. When comparing samples across experimental conditions, normalization to appropriate housekeeping proteins or total protein is essential, and researchers should be aware that mitochondrial content might vary between conditions, potentially affecting interpretation of results focused solely on Opa1 levels.

How does the balance between L-OPA1 and S-OPA1 forms affect cell survival under different stress conditions?

The balance between L-OPA1 (long form) and S-OPA1 (short form) significantly impacts cell survival under various stress conditions, particularly oxidative stress. Research has shown that L-OPA1 is fusion-competent, while S-OPA1 is not, and the cleavage of OPA1 associated with cellular stress results in mitochondrial fragmentation that has been linked to mitochondrial dysfunction and cell death . Studies using Opa1 variant expression systems have demonstrated that cells expressing only L-OPA1 due to absence of proteolytic processing (as in OMA1 and Yme1L double knockout cells) maintain normal cristae structure and show resistance to apoptosis .

Conversely, conditions that lead to loss of L-OPA1 with accumulation of S-OPA1 (such as in Phb2 knockout cells) cause mitochondrial fragmentation, cristae disruption, and increased sensitivity to apoptotic stimuli . Interestingly, the response to specific stressors varies - for example, under oxidative stress conditions induced by H2O2 treatment, cell lines lacking S-OPA1 show increased cell detachment and death compared to those expressing both L-OPA1 and S-OPA1 or predominantly S-OPA1 forms . This differential sensitivity to stress likely reflects the distinct roles of OPA1 forms in maintaining mitochondrial network integrity, cristae structure, and regulating cytochrome c release during apoptosis.

What is the relationship between Opa1 dysfunction and respiratory complex deficiencies in mitochondria?

Opa1 dysfunction leads to specific deficiencies in mitochondrial respiratory complexes, particularly Complex IV (cytochrome c oxidase or COX). In embryonic fibroblasts isolated from Opa1 Q285STOP mice, researchers observed a partial loss of Opa1 protein that resulted in mitochondrial respiratory deficiency with a selective reduction in respiratory Complex IV subunits . This was consistent with reduced enzymatic COX activity in these cells. Importantly, this respiratory deficiency progressively worsened as cells were passaged, suggesting an accumulative effect of Opa1 dysfunction on respiratory chain integrity.

The mechanism linking Opa1 to respiratory complex stability likely involves its role in maintaining cristae morphology, as proper cristae structure is essential for the organization and stability of respiratory supercomplexes. Additionally, Opa1 may play a role in mitochondrial quality control processes that regulate the turnover of respiratory complex subunits. The selective nature of Complex IV deficiency in Opa1-deficient cells suggests a particular vulnerability of this complex to alterations in cristae structure or other Opa1-dependent processes. This relationship between Opa1 and respiratory chain function has significant implications for understanding the cellular pathology in diseases such as DOA, where energy deficiency in highly metabolically active cells like retinal ganglion cells may contribute to neurodegeneration.

How do different Opa1 mutations correlate with clinical phenotypes in optic atrophy and related disorders?

Different types of Opa1 mutations correlate with distinct clinical phenotypes in optic atrophy and related disorders. Mutations affecting the GTPase domain, particularly missense mutations, are associated with more severe phenotypes including DOA plus syndrome, which features optic atrophy along with extra-ophthalmologic symptoms such as sensorineural hearing loss and other neurological conditions . These mutations are hypothesized to act through a dominant-negative mechanism, interfering with the function of the wild-type protein.

In contrast, nonsense or frameshift mutations that result in truncated proteins, such as those mimicked by the Opa1 Q285STOP mouse model, typically cause "pure" DOA through haploinsufficiency mechanisms . The truncated proteins are often undetectable, suggesting that they undergo degradation rather than exerting dominant-negative effects. This haploinsufficiency leads to approximately 50% reduction in Opa1 function, which is sufficient to cause optic atrophy but generally does not result in the more severe phenotypes seen with dominant-negative mutations.

Research using animal models has begun to provide mechanistic insights into these genotype-phenotype correlations. For example, Drosophila models expressing DOA plus-associated variants have shown that these mutations can have dominant-negative effects on axonal health even in the presence of normal OPA1 levels . Understanding these correlations is clinically important for predicting disease progression and guiding genetic counseling for affected families.

What approaches can be used to study the dynamic interactions between Opa1 and other mitochondrial fusion-fission proteins?

To study dynamic interactions between Opa1 and other mitochondrial dynamics proteins, researchers can employ several sophisticated approaches. Proximity-based protein interaction techniques such as proximity ligation assay (PLA), bioluminescence resonance energy transfer (BRET), or fluorescence resonance energy transfer (FRET) can detect close associations between Opa1 and proteins like Mfn1/2 (fusion) or Drp1 (fission) in living cells. For temporal resolution of these interactions during fusion or fission events, live-cell super-resolution microscopy combined with optogenetic tools to trigger localized fusion/fission can be powerful. Co-immunoprecipitation experiments using antibodies against different regions of Opa1 can identify protein complexes, while blue native gel electrophoresis can preserve and resolve native Opa1-containing complexes from mitochondrial fractions.

More advanced approaches include BioID or APEX2 proximity labeling to identify proteins in the vicinity of Opa1 under different conditions. For functional analysis of these interactions, genetic approaches using CRISPR-Cas9 to create specific mutations in interaction domains can be coupled with rescue experiments using recombinant wild-type or mutant proteins. Systems biology approaches integrating proteomics, transcriptomics, and functional data can provide comprehensive maps of how Opa1 networks respond to different cellular conditions and how these responses are altered in disease states.

How can recombinant Opa1 protein be used to develop therapeutic strategies for optic atrophy and related disorders?

Recombinant Opa1 protein offers several avenues for therapeutic development. For haploinsufficiency-based DOA, where reduced Opa1 levels cause disease, gene therapy approaches delivering wild-type Opa1 to affected tissues represent a promising strategy. Using animal models like the Opa1 Q285STOP mouse, researchers can test various delivery methods including adeno-associated virus (AAV) vectors optimized for retinal ganglion cells. Alternatively, small molecules that increase endogenous Opa1 expression or stabilize the protein could be screened using cell-based assays with reporter systems linked to Opa1 promoter activity.

For dominant-negative mutations, therapeutic approaches might include antisense oligonucleotides or RNA interference to selectively suppress expression of the mutant allele while preserving wild-type expression. CRISPR-based gene editing could potentially correct specific mutations in patient-derived cells. Another approach involves identifying compounds that modulate Opa1 processing to optimize the L-OPA1/S-OPA1 ratio, given the differential roles these forms play in cell survival under stress conditions .

Cell-based screening platforms using recombinant Opa1 variants can identify compounds that rescue mitochondrial morphology, cristae structure, or respiratory function in Opa1-deficient cells. Patient-derived induced pluripotent stem cells differentiated into retinal ganglion cells provide a disease-relevant platform for testing these therapeutic strategies before proceeding to animal models.

What are the experimental challenges in studying the role of Opa1 in maintaining cristae morphology and its relationship to bioenergetic function?

Studying Opa1's role in cristae morphology presents several experimental challenges. First, the dynamic nature of cristae remodeling requires techniques that can capture these changes with sufficient temporal and spatial resolution. While electron microscopy provides excellent spatial resolution, it offers only static snapshots. Newer approaches like cryo-electron tomography and live-cell super-resolution microscopy can partially address this limitation but require sophisticated equipment and expertise.

Second, isolating the specific effects of Opa1 on cristae morphology from its effects on fusion is challenging, as these functions are interrelated. Researchers must design careful experiments using specific Opa1 domains or mutations that differentially affect these functions. The differential roles of L-OPA1 and S-OPA1 in cristae maintenance versus fusion add another layer of complexity .

Third, establishing causal relationships between cristae morphology and bioenergetic function requires simultaneous measurement of structural parameters and functional outputs like ATP production, respiratory capacity, and proton motive force. Technical approaches combining structural imaging with functional assays in the same samples are technically demanding. Additionally, compensatory mechanisms that activate upon Opa1 dysfunction can confound interpretation of results.

Finally, heterogeneity in mitochondrial populations within single cells means that bulk measurements may miss important subpopulations with distinct morphological and functional characteristics. Single-mitochondrion analyses are technically challenging but increasingly necessary for understanding the full spectrum of Opa1's effects on mitochondrial structure and function.

What are the most promising future research directions for understanding Opa1 function in health and disease?

The most promising future research directions for Opa1 include several key areas. First, investigating tissue-specific effects of Opa1 dysfunction is critical, as different tissues show varying sensitivity to Opa1 deficiency, with retinal ganglion cells being particularly vulnerable. Understanding these tissue-specific vulnerabilities could reveal protective mechanisms that might be therapeutically exploited. Second, exploring the interplay between Opa1 and cellular stress response pathways, particularly given the interesting finding that Opa1 Q285STOP MEFs show resistance to ER stress-induced apoptosis , may uncover novel functional connections between mitochondrial dynamics and cellular resilience.

Third, characterizing the full spectrum of Opa1 interactions with other proteins, particularly those involved in mitochondrial contact sites with other organelles like the ER, could reveal new functions beyond fusion and cristae maintenance. Fourth, investigating the regulation of Opa1 processing under different physiological and pathological conditions could identify critical control points for therapeutic intervention. Finally, developing improved animal models that more precisely recapitulate human disease phenotypes, particularly the neurodegenerative aspects of DOA and DOA plus syndromes, will be essential for testing therapeutic strategies and understanding disease progression.

What methodological advances are needed to overcome current limitations in Opa1 research?

Several methodological advances would significantly enhance Opa1 research. Development of more specific and sensitive tools for detecting and quantifying different Opa1 isoforms, including antibodies that can distinguish between specific splice variants and processed forms, would improve our understanding of Opa1 regulation. Advanced imaging technologies that combine high spatial and temporal resolution for visualizing cristae dynamics in living cells, perhaps through the development of specific cristae-targeted fluorescent probes, would overcome current limitations in studying these structures.

Improved genetic models with conditional and tissue-specific Opa1 manipulation would enable more precise dissection of Opa1 functions in relevant tissues like retinal ganglion cells. Development of high-throughput screening platforms for identifying compounds that modulate Opa1 processing or function could accelerate therapeutic discovery. Finally, integration of multi-omics approaches (proteomics, metabolomics, lipidomics) with functional and structural data would provide a more comprehensive understanding of how Opa1 dysfunction affects cellular physiology at a systems level.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.