Recombinant Mouse E3 ubiquitin-protein ligase AMFR (Amfr)

Shipped with Ice Packs
In Stock

Description

3.1. Mechanistic Studies in ERAD

Recombinant AMFR is pivotal for dissecting ERAD mechanisms. It interacts with:

  • VCP/p97: Facilitates extraction of ubiquitinated substrates from the ER membrane .

  • INSIG1: Initiates sterol-mediated degradation of HMGCR .

  • UBE2G2: E2 conjugating enzyme required for ubiquitin transfer .

3.2. Disease Modeling

  • Cancer: AMFR promotes tumor metastasis by enhancing cell motility .

  • Neurodegeneration: Clears aggregates of mutant huntingtin and SOD1 in ALS models .

  • Asthma: Drives GM-CSF production in alveolar macrophages, exacerbating inflammation .

4.2. Functional Regulation

  • Autoubiquitination: AMFR undergoes self-ubiquitination via UBE2G2, modulating its stability .

  • Complex Formation: Forms clusters with FAM134B and LC3B during ER-phagy, enhancing membrane curvature induction .

4.3. Therapeutic Implications

  • Cancer Therapy: Inhibiting AMFR reduces metastasis in murine models .

  • Neuroprotection: Overexpression mitigates proteotoxicity in Parkinson’s and Huntington’s disease models .

Challenges and Future Directions

  • Structural Dynamics: Further crystallography studies are needed to resolve full-length AMFR structure .

  • Ligand Interactions: The role of AMFR’s N-terminal domain in substrate recognition remains unclear .

  • Therapeutic Targeting: Developing small-molecule inhibitors of AMFR’s RING domain could treat cancer and neurodegeneration .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for the estimated delivery time.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate this requirement to us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. To enhance long-term storage stability, we recommend adding 5-50% glycerol (final concentration) and aliqouting the reconstituted protein for storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by multiple factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliqouting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
Amfr; E3 ubiquitin-protein ligase AMFR; Autocrine motility factor receptor; AMF receptor; RING-type E3 ubiquitin transferase AMFR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-643
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MPLLFLERFPWPSLRTYTGLSGLALLGTIVSAYRALSQPEDGSGEPEPLTAPLQPEALAP ARLTAGGPRARDVAQYLLSDSLFVWVLVNTACCVLMLVAKLIQCIVFGPLRVSERQHLKD KFWNFIFYKFIFIFGVLNVQTVEEVVMWCLWFAGLVFLHLMVQLCKDRFEYLSFSPTTPM SSHGRVLSLLIAMLLSCCGLAVVCCVTGYTHGMHTLAFMAAESLLVTVRTAHVILRYVIH LWDLNHEGTWEGKGTYVYYTDFVMELALLSLDLMHHIHMLLFGNIWLSMASLVIFMQLRY LFHEVQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQAARKLPCGHLF HNSCLRSWLEQDTSCPTCRMSLNIADGSRAREDHQGENLDENLVPVAAAEGRPRLNQHNH FFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDL QMTRSVEITTDNILEGRIQVPFPTQRSDSLRPALNSPVERPSPDLEEGEASVQTERVPLD LSPRLEETLDFSEVELEPIEVEDFEARGSRFSKSADERQRMLVQRKDDLLQQARKRFLNK SSEDDGASERLLPSEGTSSDPVTLRRRMLAAAAERRLQRQRTT
Uniprot No.

Target Background

Function
E3 ubiquitin-protein ligase that mediates the polyubiquitination of lysine and cysteine residues on target proteins, leading to proteasomal degradation. These target proteins include CD3D, CYP3A4, CFTR, INSIG1, SOAT2/ACAT2 and APOB. AMFR is a component of a VCP/p97-AMFR/gp78 complex involved in the final stage of endoplasmic reticulum-associated degradation (ERAD). This complex plays a crucial role in the sterol-accelerated ERAD degradation of HMGCR by binding to the HMGCR-INSIG1 complex at the ER membrane. Furthermore, AMFR's interaction with AUP1 facilitates its association with ubiquitin-conjugating enzyme UBE2G2 and ubiquitin ligase RNF139, ultimately leading to sterol-induced HMGCR ubiquitination. The ubiquitinated HMGCR is then released from the ER by the complex into the cytosol for subsequent degradation. Beyond ubiquitination on lysine residues, AMFR also catalyzes ubiquitination on cysteine residues. In conjunction with INSIG1, it mediates polyubiquitination of SOAT2/ACAT2 at 'Cys-277', triggering its degradation when lipid levels are low. AMFR also catalyzes ubiquitination and subsequent degradation of INSIG1 when cells are depleted of sterols. It mediates polyubiquitination of INSIG2 at 'Cys-215' in some tissues, leading to its degradation. AMFR also regulates ERAD through the ubiquitination of UBL4A, a component of the BAG6/BAT3 complex. Additionally, it acts as a scaffold protein, assembling a complex that couples ubiquitination, retranslocation, and deglycosylation. AMFR contributes to tumor invasion and metastasis as a receptor for the GPI/autocrine motility factor. In association with LMBR1L and UBAC2, it negatively regulates the canonical Wnt signaling pathway in lymphocytes by promoting the ubiquitin-mediated degradation of CTNNB1 and Wnt receptors FZD6 and LRP6.
Gene References Into Functions
  1. Investigates the role of gp78 and cidec in hepatic steatosis. PMID: 28656280
  2. Gp78, an E3 ubiquitin ligase, acts as a gatekeeper suppressing nonalcoholic steatohepatitis (NASH) and liver cancer. PMID: 25789613
  3. Role in innate immunity and STING signaling pathway. PMID: 25526307
  4. The ubiquitin ligase gp78, known for its role in protein quality control, is critical for unglycosylated PrP ubiquitylation and degradation. PMID: 24714645
  5. While consistent involvement of gp78 in Insig-1 degradation is observed, there is no substantive evidence supporting roles for either gp78 or TRC8 in the robust sterol-accelerated degradation of HMG-CoA reductase. PMID: 23087214
  6. Ablation of gp78 in the liver improves hyperlipidemia and insulin resistance by inhibiting SREBP to decrease lipid biosynthesis. PMID: 22863805
  7. Palmitoylation of RING finger cysteines therefore regulates gp78 distribution to the peripheral ER. PMID: 22728137
  8. AMFR is involved in the process of learning and memory in the central nervous system. PMID: 22313999
  9. KAI1 plays a role in promoting cell proliferation and mammary gland hyperplasia through the gp78 ubiquitin ligase. PMID: 20089858
  10. Cytoplasmic protein mouse p97(mp97) participates in the formation of a ternary complex containing mouse autocrine motility factor receptor (mAMFR), mp97, and peptide N-glycanase. PMID: 16709668
  11. The receptor molecule for AMF/NLK/MF in leukemic differentiation is not gp78. PMID: 17071500
  12. Endoplasmic reticulum (ER) stress differentially regulates the stabilities of Endoplasmic reticulum associated degradation (ERAD)E3s and their substrates, which may represent a novel mechanism by which ER stress increases ERAD. PMID: 17157811
  13. gp78 promotes sarcoma metastasis by targeting KAI1 for degradation. PMID: 18037895
  14. Small interfering RNA methods have revealed that the ubiquitin ligase RMA1 functions as an E3 enzyme upstream of gp78. PMID: 18216283

Show More

Hide All

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in heart, brain, liver, lung, skeletal muscle, kidney and testis. Not detected in spleen.

Q&A

What is the basic structure and function of mouse E3 ubiquitin-protein ligase AMFR?

Mouse E3 ubiquitin-protein ligase AMFR (also known as gp78) is a membrane-bound ubiquitin ligase that plays a crucial role in endoplasmic reticulum-associated degradation (ERAD) pathways. Structurally, it contains multiple domains including a transmembrane domain, a RING finger domain essential for its ligase activity, and CUE and VIM domains that facilitate protein-protein interactions. The protein functions by catalyzing the transfer of ubiquitin to substrate proteins, thereby targeting them for proteasomal degradation. This mechanism is fundamental to protein quality control and homeostasis within cells, particularly for misfolded or damaged proteins in the endoplasmic reticulum.

Similar to human AMFR, mouse AMFR contains a full-length sequence of approximately 643 amino acids, though there may be species-specific variations in exact length and sequence . The protein is typically expressed with tags (such as His-tag) to facilitate purification and detection in experimental settings.

How does mouse AMFR differ from human AMFR in sequence and function?

While mouse and human AMFR share significant homology, there are notable differences in amino acid sequence that may affect specific protein-protein interactions or substrate recognition patterns. Both proteins maintain the core functional domains including the RING finger domain critical for E3 ligase activity, but researchers should be aware that experimental findings from one species may not translate perfectly to the other.

When comparing functional studies, human AMFR (as seen in product specifications) typically contains 643 amino acids in its full-length form , and the mouse ortholog has a highly conserved structure. Functional conservation between species makes mouse AMFR a valuable model for studying ubiquitination pathways relevant to human health and disease.

What are the optimal expression systems for producing recombinant mouse AMFR?

For recombinant mouse AMFR expression, E. coli systems are commonly employed for producing the full-length protein or specific domains. Based on protocols for similar proteins, expression in E. coli with an N-terminal His-tag facilitates efficient purification using affinity chromatography . When expressing the full transmembrane protein, consider the following methodology:

  • Clone the mouse AMFR cDNA into an expression vector with an N-terminal His-tag

  • Transform into an E. coli strain optimized for recombinant protein expression (e.g., BL21(DE3))

  • Induce expression with IPTG at lower temperatures (16-18°C) to enhance proper folding

  • Lyse cells and purify using Ni-NTA affinity chromatography

  • Further purify using size exclusion chromatography if higher purity is required

For membrane-bound portions of the protein, mammalian or insect cell expression systems may provide better folding and post-translational modifications than bacterial systems.

What are the recommended storage and reconstitution methods for recombinant mouse AMFR?

Based on protocols for similar recombinant proteins, the following storage and reconstitution guidelines are recommended:

ParameterRecommendation
Storage FormLyophilized powder
Storage Temperature-20°C to -80°C
ReconstitutionIn sterile PBS to 0.1-1.0 mg/mL
Long-term StorageAdd glycerol (final concentration 5-50%, with 50% being optimal) and store in aliquots at -20°C to -80°C
Working Storage4°C for up to one week
AvoidRepeated freeze-thaw cycles

Proper reconstitution typically involves briefly centrifuging the vial before opening to ensure all material is at the bottom, then adding the appropriate buffer volume . For functional studies, consider adding protease inhibitors to prevent degradation, particularly if the preparation will be used for enzymatic assays.

What are the validated methods for assessing mouse AMFR ubiquitin ligase activity in vitro?

Several robust methodologies can be employed to assess the ubiquitin ligase activity of recombinant mouse AMFR:

  • In vitro ubiquitination assay: Combine purified recombinant AMFR with E1 (ubiquitin-activating enzyme), E2 (ubiquitin-conjugating enzyme), ubiquitin, ATP, and substrate protein. Analyze ubiquitinated products via western blot.

  • FRET-based activity assays: Utilize fluorescently labeled ubiquitin to monitor transfer reactions in real-time.

  • Substrate degradation assays: Measure the rate of degradation of known AMFR substrates in the presence of the recombinant protein.

A typical reaction mixture contains:

  • 50-100 ng purified recombinant AMFR

  • 100-200 ng E1 enzyme

  • 500 ng-1 μg appropriate E2 enzyme (usually UBC7/UBE2G2)

  • 5-10 μg ubiquitin

  • 2-5 mM ATP

  • 50-100 ng substrate protein

  • Buffer containing 25 mM Tris-HCl (pH 7.5), 50 mM NaCl, 5 mM MgCl₂, 0.1 mM DTT

Incubate the reaction at 30°C for 1-2 hours and analyze by SDS-PAGE followed by western blotting using antibodies against the substrate protein or ubiquitin.

How can mouse AMFR be used to study endoplasmic reticulum-associated degradation (ERAD) pathways?

Recombinant mouse AMFR serves as an excellent tool for investigating ERAD mechanisms through several experimental approaches:

  • Substrate identification studies: Using recombinant AMFR in pull-down assays coupled with mass spectrometry to identify novel substrates targeted for degradation.

  • Reconstituted ERAD systems: Creating in vitro systems combining recombinant AMFR with other ERAD components (Derlin-1, p97/VCP, UBE2G2) to study the sequential steps of substrate recognition, ubiquitination, and extraction from the ER membrane.

  • Structure-function analysis: Engineering domain-specific mutations in recombinant AMFR to dissect the roles of individual domains in substrate recognition and processing.

  • Comparative pathway analysis: Using mouse AMFR alongside other E3 ligases involved in ERAD (HRD1, RNF5) to determine pathway specificity and redundancy for different substrates.

When designing these experiments, researchers should consider using appropriate controls including catalytically inactive AMFR mutants (RING domain mutations) to distinguish between specific and non-specific interactions.

What are the key differences in experimental approaches when studying membrane-bound versus soluble domains of mouse AMFR?

Studying membrane-bound and soluble domains of mouse AMFR requires different experimental strategies:

For membrane-bound full-length AMFR:

  • Expression in mammalian or insect cell systems that better support membrane protein folding

  • Detergent-based extraction methods using mild detergents (DDM, CHAPS, or digitonin)

  • Reconstitution into artificial membrane systems (liposomes or nanodiscs) for functional studies

  • Microscopy-based localization studies to confirm proper membrane insertion

For soluble domains (e.g., the cytosolic RING finger domain):

  • Bacterial expression systems (E. coli) can provide high yields

  • Standard affinity chromatography purification without detergents

  • Crystal structure determination or NMR studies become feasible

  • Solution-based biochemical assays for activity assessment

The choice between studying the full-length protein versus isolated domains depends on the specific research question. While isolated domains may provide mechanistic insights into specific functions, the full-length protein is necessary to understand how membrane association influences activity and interactions with substrates and cofactors.

What are common challenges in expressing and purifying active mouse AMFR, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant mouse AMFR:

  • Poor solubility and aggregation:

    • Solution: Express at lower temperatures (16-18°C)

    • Add solubility enhancers like 0.1% Triton X-100 or low concentrations of urea (1-2 M)

    • Consider fusion partners like MBP or SUMO that enhance solubility

  • Low expression levels:

    • Optimize codon usage for the expression system

    • Screen multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express)

    • Test different induction conditions (IPTG concentration, temperature, duration)

  • Protein degradation:

    • Add protease inhibitors during all purification steps

    • Work at 4°C throughout the purification process

    • Consider auto-ubiquitination of AMFR during storage; add deubiquitinating enzymes if necessary

  • Loss of activity after purification:

    • Include zinc in buffers (10-50 μM ZnCl₂) to maintain RING finger structure

    • Add reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

    • Store in glycerol at -80°C in small aliquots to avoid repeated freeze-thaw cycles

For membrane-associated regions, extraction efficiency can be improved by screening different detergents (DDM, CHAPS, NP-40) at various concentrations to identify optimal solubilization conditions while maintaining native protein conformation.

How can researchers validate the structural integrity and activity of purified recombinant mouse AMFR?

Comprehensive validation of recombinant mouse AMFR should include:

  • Structural validation:

    • SDS-PAGE and western blot to confirm molecular weight and purity (>90% purity is ideal)

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Limited proteolysis to verify proper folding (correctly folded proteins show resistance to proteolytic digestion at low protease concentrations)

    • Dynamic light scattering to detect aggregation

  • Functional validation:

    • In vitro ubiquitination assays using known substrates

    • Auto-ubiquitination assays (AMFR can ubiquitinate itself in the presence of E1, E2, and ubiquitin)

    • Binding assays with known interaction partners (p97/VCP, Derlin-1)

    • ATPase activity assays if studying the p97-AMFR complex

  • Activity controls:

    • Include a catalytically inactive mutant (mutations in the RING domain) as a negative control

    • Compare activity to commercially available standards when possible

    • Establish dose-dependency of enzymatic activity

For quantitative assessment of purity, techniques such as high-performance liquid chromatography (HPLC) or capillary electrophoresis can supplement visual assessment by SDS-PAGE.

How can recombinant mouse AMFR be used to study its role in lipid metabolism regulation?

Mouse AMFR plays a significant role in lipid metabolism through the regulation of key enzymes like HMG-CoA reductase and Insig-1. Researchers can design the following experiments using recombinant AMFR:

  • Reconstituted ubiquitination assays: Using purified recombinant AMFR to ubiquitinate lipid metabolism enzymes in vitro, researchers can analyze:

    • Ubiquitination patterns (K48 vs. K63 linkages)

    • Rate of ubiquitination under varying sterol conditions

    • Requirements for additional cofactors

  • Sterol-dependent interaction studies:

    • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) to measure binding kinetics between AMFR and Insig-1 under different sterol concentrations

    • Pull-down assays using recombinant AMFR to isolate interacting partners from cellular extracts with or without sterols

  • Structure-function analyses:

    • Create domain-specific mutations to map regions required for sterol-dependent substrate recognition

    • Identify critical residues involved in the AMFR-Insig-1 interaction

When designing these experiments, include appropriate controls such as sterol-insensitive mutants and compare results with other E3 ligases to establish specificity of AMFR in lipid metabolism regulation.

What are the recommended approaches for studying mouse AMFR in cancer research models?

Recombinant mouse AMFR can be utilized in cancer research through several methodological approaches:

  • Substrate profiling in cancer cells:

    • Perform comparative ubiquitinome analysis in normal versus cancer cells with AMFR overexpression or knockdown

    • Use recombinant AMFR in pull-down assays followed by mass spectrometry to identify cancer-specific substrates

  • Functional rescue experiments:

    • Complement AMFR-knockout cancer cell lines with wild-type or mutant recombinant AMFR

    • Assess effects on proliferation, migration, and resistance to ER stress-inducing chemotherapeutics

  • Drug discovery applications:

    • Develop high-throughput screening assays using recombinant AMFR to identify small molecule inhibitors

    • Structure-based drug design targeting AMFR-substrate interactions

  • Biomarker development:

    • Use recombinant AMFR to generate and validate antibodies for immunohistochemistry

    • Develop activity-based probes to assess AMFR function in tumor samples

When conducting these studies, researchers should control for the effects of tags (His, GST) on protein function and consider using tag-removal systems when necessary for in vivo applications.

How should researchers interpret contradictory results between in vitro and cellular studies of mouse AMFR function?

When faced with discrepancies between in vitro studies using recombinant AMFR and cellular experiments, consider the following analytical approach:

  • Evaluate experimental conditions:

    • In vitro systems may lack critical cofactors present in cells

    • Recombinant protein may have structural differences from cellular AMFR due to post-translational modifications or membrane environment

    • Buffer conditions (pH, salt concentration) may not reflect cellular environment

  • Consider protein interactions:

    • AMFR functions in multi-protein complexes that may not be fully reconstituted in vitro

    • Interactions with p97/VCP, Derlin-1, or other ERAD components may be necessary for physiological function

  • Examine substrate specificity:

    • Confirm that the substrate concentration used in vitro reflects physiological levels

    • Validate that substrate is properly folded/unfolded to match its state in cells

  • Reconciliation strategies:

    • Design hybrid experiments (cell extracts with recombinant protein additions)

    • Create semi-permeabilized cell systems that allow introduction of recombinant proteins

    • Use structure-function studies to identify specific domains responsible for discrepancies

What statistical approaches are most appropriate for analyzing enzyme kinetics data from recombinant mouse AMFR studies?

For rigorous analysis of mouse AMFR enzymatic activity, researchers should employ these statistical approaches:

  • Michaelis-Menten kinetics analysis:

    • Determine Km and Vmax using non-linear regression of initial velocity data

    • Calculate catalytic efficiency (kcat/Km) to compare wild-type and mutant AMFR

    • Use Lineweaver-Burk or Eadie-Hofstee plots as secondary confirmation

  • Progress curve analysis:

    • Fit complete reaction progress curves to integrated rate equations

    • Account for product inhibition and substrate depletion

  • Statistical validation:

    • Perform experiments in triplicate minimally

    • Use ANOVA for comparing multiple conditions

    • Apply appropriate post-hoc tests (Tukey, Bonferroni) for multiple comparisons

    • Report confidence intervals rather than just p-values

  • Controls and normalizations:

    • Include internal standards to normalize between experiments

    • Correct for non-enzymatic background reactions

    • Validate linear range of detection systems

A typical data presentation should include:

  • Plots showing raw data points with error bars (standard deviation or standard error)

  • Fitted curves with 95% confidence intervals

  • Tables of derived kinetic parameters with associated statistical measures

  • Comparisons to published values for related E3 ligases when available

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.