Recombinant Mouse E3 ubiquitin-protein ligase MARCH11 (41344)

Shipped with Ice Packs
In Stock

Description

Introduction

E3 ubiquitin-protein ligases, such as Recombinant Mouse E3 ubiquitin-protein ligase MARCH11 (41344), play a crucial role in the ubiquitin-proteasome system (UPS) . The UPS is essential for maintaining cellular homeostasis through the selective degradation of intracellular proteins . E3 ubiquitin ligases confer specificity to the ubiquitylation process by recognizing and binding to specific substrate proteins .

Overview of E3 Ubiquitin Ligases

E3 ubiquitin ligases mediate the transfer of ubiquitin from an E2 ubiquitin-conjugating enzyme to a target protein . This process marks the protein for degradation or alters its function . The human genome encodes a large number of E3 ligases, highlighting their importance in regulating diverse cellular pathways .

MARCH Family of E3 Ubiquitin Ligases

MARCH11 belongs to the MARCH (Membrane-Associated Ring-CH) family of E3 ubiquitin ligases . MARCH proteins are characterized by a RING-CH domain and transmembrane domains . Most mammalian MARCH proteins, including MARCH11, share a similar structure, featuring an N-terminal RING-CH finger and multiple transmembrane domains . Phylogenetic analysis classifies transmembrane-containing MARCH proteins into subgroups such as MARCH1/8, MARCH2/3, MARCH4/9/11, MARCH5, and MARCH6 .

Subcellular Localization

MARCH11 is localized on multi-vesicular bodies (MVBs) and the trans-Golgi network (TGN) . The PDZ-binding domain plays a significant role in determining the subcellular localization of MARCH proteins; mutations in this domain can lead to retention in the endoplasmic reticulum (ER) .

Regulation of MARCH Proteins

MARCH proteins are regulated by post-translational modifications (PTMs), including ubiquitination . Ubiquitination regulates the stability of several MARCH proteins . For example, MARCH1 maintains a low protein level in antigen-presenting cells (APCs) through transmembrane-mediated dimerization, leading to autoubiquitination and degradation .

Functional Role of MARCH11

MARCH11 mediates polyubiquitination of CD4, an essential protein in immune response . It appears to have a role in ubiquitin-mediated protein sorting in the TGN-MVB transport pathway .

MARCH Proteins and Immune Response

MARCH proteins target immune receptors, viral proteins, and components of the innate immune response for polyubiquitination and degradation . Several MARCH proteins can down-regulate MHC-I . For example, MARCH4 monoubiquitinates MHC-I, leading to endocytosis and degradation from the cell surface .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. Please indicate your desired tag type for preferential development.
Synonyms
Marchf11; March11; E3 ubiquitin-protein ligase MARCHF11; Membrane-associated RING finger protein 11; Membrane-associated RING-CH protein XI; MARCH-XI; RING-type E3 ubiquitin transferase MARCHF11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-400
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
March11
Target Protein Sequence
MSDEGKKRSSRADSLEAEPPLPPPPPPPPPGESVLVPTSPRYRPPLPAPLERIVGSGEPP VELAPRRKGAGEPLPPLPPSLLPGDQEVTAAGDSCEGPRRLPEVKLPEAATGKGSPGEPE AGACREGERRGTGDQPETRSVCSSRSSSSGGGSDQRSGHQHQHHQPICKICFQGAEQGEL LNPCRCDGSVRYTHQLCLLKWISERGSWTCELCCYRYHVTAIKMKQPCQWQSISITLVEK VQMIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQICYGMYGFMDLVCIGLIVHEG AAVYRVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLSALRNRNLVHPTQL TSPRFQCGYVLLHLFNRMRAHEDVSEDNGSGEVVMRVTSV
Uniprot No.

Target Background

Function

MARCH11 is an E3 ubiquitin-protein ligase mediating the polyubiquitination of CD4. As an E3 ligase, it accepts ubiquitin from an E2 ubiquitin-conjugating enzyme via a thioester bond and directly transfers the ubiquitin to target substrates. MARCH11 may play a role in ubiquitin-dependent protein sorting within developing spermatids.

Gene References Into Functions
  1. Studies indicate that SAMT1 proteins are physiological substrates of MARCH11 and are targeted to lysosomes via the TGN-MVB pathway through a ubiquitin-dependent sorting mechanism in mouse spermatids. PMID: 22075566
Database Links
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein.

Q&A

What is Mouse E3 ubiquitin-protein ligase MARCH11 and how does it function?

MARCH11 belongs to the MARCH (Membrane-Associated RING-CH) family of E3 ubiquitin ligases. These proteins contain a characteristic RING-CH domain (C4HC3) that distinguishes them from other RING-type E3 ligases like RING-HC (C3HC4) and RING-H2 (C3H2C3) . MARCH proteins typically function by facilitating the transfer of ubiquitin from E2 enzymes to substrate proteins, thereby targeting them for degradation via either proteasomal or lysosomal pathways. MARCH11 specifically functions as a transmembrane E3 ligase involved in protein quality control mechanisms and intracellular protein trafficking .

Unlike enzymatic E3 ligases, MARCH11 and other RING-type E3s act non-enzymatically by bringing E2-ubiquitin complexes into proximity with target substrates. This positioning enables efficient ubiquitin transfer to substrate lysine residues, forming isopeptide bonds that signal for protein degradation or altered trafficking .

How does MARCH11 differ structurally from other MARCH family members?

MARCH11, like other MARCH proteins, shares the common domain organization of a type III membrane protein . Its structure typically includes:

  • An N-terminal cytosolic region containing the conserved RING-CH domain

  • Two transmembrane domains that anchor the protein in cellular membranes

  • A C-terminal domain that extends into the cytosol

  • A short (approximately 12 amino acid) segment in the ER lumen between the transmembrane domains

This topology ensures that both the N-terminal RING-CH domain and C-terminal domain face the cytosol, allowing interaction with cytosolic ubiquitination machinery while simultaneously recognizing membrane-associated targets.

While MARCH family members share this general architecture, MARCH11 has specific sequence variations in its C-terminal domain that influence substrate specificity and intracellular localization .

What are the recommended experimental designs for studying MARCH11 function?

When designing experiments to study MARCH11 function, researchers should employ true experimental designs with the following essential components:

  • Manipulation of the independent variable: This involves systematic variation of MARCH11 expression or activity through techniques such as overexpression, knockdown, or use of recombinant protein .

  • Experimental control: Include proper control groups (e.g., cells expressing catalytically inactive MARCH11 mutants) to isolate MARCH11-specific effects from background processes .

  • Random assignment: When using animal models or cell populations, employ random assignment techniques to minimize selection bias and ensure group equivalence at baseline .

The strongest design for determining cause-effect relationships between MARCH11 and cellular phenotypes is a randomized controlled trial (RCT) approach, where the only expected difference between experimental and control groups is the manipulation of MARCH11 .

How can I validate substrate specificity of recombinant MARCH11 in my experiments?

Validating substrate specificity requires a multi-pronged approach:

  • Co-immunoprecipitation studies: Detect physical interactions between MARCH11 and potential substrate proteins.

  • Ubiquitination assays: Perform in vitro and in vivo ubiquitination assays with recombinant MARCH11 and candidate substrates, analyzing ubiquitination patterns through western blotting.

  • Substrate level monitoring: Measure changes in protein levels of putative substrates in response to MARCH11 manipulation.

  • Mutational analysis: Create lysine-free mutants of candidate substrates to identify specific ubiquitination sites, similar to studies with other MARCH proteins .

  • Competitive binding assays: Determine whether different substrates compete for MARCH11 binding, suggesting shared recognition mechanisms.

It's important to note that MARCH proteins often recognize binding partners beyond their substrates. For example, viral MARCH protein mK3 primarily binds to TAP rather than its substrate HC . Therefore, investigations should consider both direct and indirect substrate interactions.

How does MARCH11 contribute to protein quality control mechanisms?

MARCH11, like other MARCH family members, likely participates in protein quality control through ER-associated degradation (ERAD) pathways. Based on studies of related MARCH proteins, MARCH11 may function by:

  • Substrate recognition: Recognizing misfolded or improperly assembled proteins through direct binding or via adaptor proteins.

  • Ubiquitination: Tagging recognized substrates with ubiquitin chains to mark them for degradation.

  • Dislocation facilitation: Potentially participating in the partial dislocation of membrane-bound substrates from the ER lumen, allowing ubiquitination on exposed regions .

  • Degradation targeting: Directing ubiquitinated substrates to either proteasomal or lysosomal degradation pathways.

Research on viral MARCH protein mK3 has revealed that some membrane-bound ERAD substrates undergo a partial dislocation process where the N-terminus is dislocated from the ER lumen, ubiquitinated, and then fully extracted to the cytosol . MARCH11 may employ similar mechanisms for its substrates.

What methodological approaches can address contradictory findings in MARCH11 research?

When faced with contradictory findings about MARCH11 function:

  • Systematic review methodology: Compile all available data on MARCH11 using structured literature review techniques to identify patterns and sources of discrepancy.

  • Standardized experimental conditions: Ensure experimental reproducibility by standardizing protein preparation, storage conditions, and assay protocols.

  • Multiple model systems: Test MARCH11 function across different cell types and model organisms to determine context-dependent effects.

  • Domain-specific analysis: Create and test truncated or chimeric MARCH11 constructs to isolate functions of specific protein domains.

  • Temporal considerations: Examine MARCH11 activity at different time points to identify potential biphasic or time-dependent effects.

A particularly powerful approach is to combine genetic and biochemical methods - for example, using CRISPR-Cas9 to generate MARCH11-deficient cells, then reconstituting with wild-type or mutant MARCH11 to observe differential effects on substrate fate.

What are the optimal conditions for maintaining recombinant MARCH11 activity in vitro?

Maintaining recombinant MARCH11 activity requires careful attention to:

  • Buffer composition: Use buffers containing mild detergents (e.g., 0.1% CHAPS or 0.1% NP-40) to maintain solubility of this transmembrane protein while preserving structure.

  • Reducing conditions: Include reducing agents (e.g., DTT or β-mercaptoethanol) at low concentrations to maintain the integrity of the zinc-binding RING-CH domain .

  • Temperature control: Store aliquoted protein at -80°C for long-term storage; avoid repeated freeze-thaw cycles.

  • Zinc supplementation: Include low concentrations of ZnCl2 (1-10 μM) in buffers to stabilize the RING domain structure.

  • Protein concentration: Maintain protein at concentrations above 0.1 mg/mL to prevent surface adsorption and denaturation.

When designing activity assays, include appropriate positive controls such as other well-characterized E3 ligases and negative controls like heat-inactivated MARCH11 to validate assay performance.

How can I optimize detection of MARCH11-mediated ubiquitination in cellular systems?

Detecting MARCH11-mediated ubiquitination presents several challenges due to the often rapid degradation of ubiquitinated substrates. Consider these strategies:

  • Proteasome/lysosome inhibition: Treat cells with MG132 (proteasome inhibitor) or bafilomycin A1 (lysosomal inhibitor) to accumulate ubiquitinated species.

  • Tandem ubiquitination tags: Use cell lines expressing tagged ubiquitin constructs (e.g., His-Biotin-Ub) to facilitate pulldown of ubiquitinated proteins.

  • Targeted mass spectrometry: Employ ubiquitin remnant motif (K-ε-GG) antibodies for enrichment of ubiquitinated peptides followed by mass spectrometry analysis.

  • Live-cell imaging: Utilize fluorescent ubiquitin sensors to monitor ubiquitination dynamics in real-time.

  • Sequential immunoprecipitation: First immunoprecipitate candidate substrates, then immunoblot for ubiquitin, or vice versa.

When investigating membrane-bound substrates, consider that ubiquitination may occur on cytosolically-exposed lysines, luminally-exposed lysines after partial dislocation, or potentially on non-lysine residues under certain conditions .

What statistical approaches are recommended for analyzing MARCH11 substrate identification data?

Analysis of MARCH11 substrate identification data requires robust statistical methods:

Statistical ApproachApplicationAdvantagesLimitations
Multiple hypothesis correctionProteomics dataControls false discovery rateMay increase false negatives
Pathway enrichment analysisIdentifying biological processesReveals functional patternsDepends on pathway annotation quality
Supervised machine learningPredicting new substratesCan identify subtle patternsRequires substantial training data
Bayesian network analysisModeling regulatory relationshipsCaptures conditional dependenciesComputationally intensive
Permutation testingValidating enrichment significanceDistribution-free approachMay be overly conservative

When integrating proteomics data for substrate identification, implement targeted experimental validation for high-confidence candidates emerging from statistical analysis. Ubiquitination site prediction algorithms can help prioritize substrates for validation, but should not replace experimental verification.

How can I distinguish between direct and indirect effects of MARCH11 in experimental systems?

Distinguishing direct from indirect effects requires multiple complementary approaches:

  • In vitro reconstitution: Perform ubiquitination assays with purified components (E1, E2, MARCH11, and substrate) to demonstrate direct activity.

  • Rapid induction systems: Use systems like auxin-inducible degron technology for acute MARCH11 manipulation to separate immediate (likely direct) from delayed (potentially indirect) effects.

  • Binding site mutations: Introduce mutations in substrate binding regions without affecting MARCH11 catalytic activity to confirm direct targeting.

  • Proximity labeling: Employ BioID or APEX2 fusion proteins to identify proteins in close physical proximity to MARCH11 in living cells.

  • Interactome analysis: Compare MARCH11 interactome with observed cellular effects to identify potential intermediaries.

Remember that MARCH proteins often rely on adaptor proteins for substrate recognition. For example, viral MARCH protein mK3 primarily binds to TAP rather than directly to its substrate HC . Therefore, lack of direct binding does not necessarily indicate an indirect effect.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.