Recombinant Mouse E3 ubiquitin-protein ligase MARCH3 (41336)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
Marchf3; March3; E3 ubiquitin-protein ligase MARCHF3; Membrane-associated RING finger protein 3; Membrane-associated RING-CH protein III; MARCH-III; RING-type E3 ubiquitin transferase MARCHF3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-218
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
March3
Target Protein Sequence
MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLA TQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRF AVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRL EAVGLIALTVALFTIYLFWTLRRYGHQSKPFWNQSSRS
Uniprot No.

Target Background

Function

MARCH3 is an E3 ubiquitin-protein ligase potentially involved in endosomal trafficking. E3 ubiquitin ligases receive ubiquitin from an E2 ubiquitin-conjugating enzyme via a thioester linkage and subsequently transfer the ubiquitin to target substrates.

Database Links
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.

Q&A

What is E3 ubiquitin-protein ligase MARCH3 and what is its primary function?

E3 ubiquitin-protein ligase MARCH3 (Membrane-Associated RING-CH-3) belongs to the RING-CH-type finger E3 ubiquitin ligase family. It primarily functions as a negative regulator of cytokine signaling pathways, particularly the IL-6 and OSM-induced STAT3 activation pathways. MARCH3 mediates the polyubiquitination of key receptor components like IL-6Rα and gp130, targeting them for degradation . Additionally, MARCH3 plays a significant role in maintaining endothelial barrier integrity through regulation of cell junction proteins . The protein predominantly localizes to late endosomes/lysosomes, suggesting its involvement in the degradation pathway of membrane proteins.

What are the key structural domains of MARCH3 essential for its function?

The primary functional domain of MARCH3 is its RING-CH domain, which confers E3 ubiquitin ligase activity. Within this domain, specific conserved cysteine residues (C71, C74, and C87) are particularly critical, as mutations at these positions (C71S, C74S, and C87S) render MARCH3 catalytically inactive . These mutants fail to decrease levels of target substrates and do not enhance polyubiquitination of target proteins. Beyond the RING-CH domain, MARCH3 contains transmembrane domains that anchor it to membrane structures, particularly late endosomes and lysosomes, facilitating its ability to target membrane-associated proteins for ubiquitination and subsequent degradation .

How does MARCH3 regulate cellular signaling pathways?

MARCH3 serves as a negative regulator of several important signaling cascades, most notably the IL-6 and OSM-induced STAT3 activation pathways. Mechanistically, MARCH3 targets the high-molecular-weight glycosylated forms of IL-6Rα and gp130 for ubiquitin-mediated degradation . Research demonstrates that MARCH3 promotes both K48-linked (associated with proteasomal degradation) and K63-linked polyubiquitination of IL-6Rα, as well as K48-linked polyubiquitination of gp130 . This reduces receptor availability for cytokine binding and attenuates downstream signal transduction.

What experimental models are commonly used to study MARCH3 function?

Several experimental models have been employed to investigate MARCH3 function:

Model TypeSpecific ModelsApplicationsKey Considerations
Cell LinesHeLa, TF-1 cellsSignaling pathway studiesEasily transfectable, responsive to IL-6/OSM
Endothelial ModelsHUVECs, hCMECBarrier function studiesMaintain at low passage numbers
Genetic ManipulationRNAi, CRISPR-Cas9Loss-of-function studiesValidate knockdown/knockout efficiency
Expression SystemsWT and mutant MARCH3Structure-function analysisConsider expression levels and tags

For cytokine signaling research, HeLa cells provide an excellent model for overexpression and knockdown studies examining effects on signaling pathways . TF-1 cells have been utilized to study MARCH3's role in ubiquitination events. For endothelial barrier studies, human umbilical vein endothelial cells (HUVECs) and human cerebral microvascular endothelial cells (hCMEC) serve as relevant physiological models .

How can I design experiments to study MARCH3's role in the IL-6/STAT3 signaling pathway?

To comprehensively investigate MARCH3's role in IL-6/STAT3 signaling, implement a multi-faceted experimental approach:

  • Establish appropriate cell models:

    • Generate MARCH3 knockdown cells using RNAi or CRISPR-Cas9 technology

    • Create cell lines expressing wild-type MARCH3 or catalytically inactive mutants (C71S, C74S, C87S)

    • Select cell types that are responsive to IL-6 stimulation (e.g., HeLa, TF-1, or hepatocytes)

  • Analyze signaling dynamics:

    • Examine IL-6-induced STAT3 phosphorylation (particularly at Y705) via Western blotting

    • Perform time-course experiments (0-24h) to assess how MARCH3 affects signaling duration

    • Measure expression of STAT3 target genes using qPCR

  • Investigate receptor dynamics:

    • Conduct pulse-chase experiments to determine IL-6Rα and gp130 half-lives

    • Use cell surface biotinylation to monitor receptor internalization

    • Perform immunofluorescence microscopy to track receptor localization

  • Characterize ubiquitination patterns:

    • Conduct immunoprecipitation followed by ubiquitin immunoblotting

    • Compare K48 vs. K63 polyubiquitination of IL-6Rα and gp130

    • Perform in vitro ubiquitination assays with purified components

Researchers have observed that MARCH3 overexpression inhibits IL-6- and OSM-induced phosphorylation of STAT3 Y705 in HeLa cells, while MARCH3 knockdown enhances IL-6- and OSM-induced transcription of downstream genes . These experimental strategies will provide comprehensive insights into how MARCH3 regulates the IL-6/STAT3 signaling axis at multiple levels.

What techniques are effective for analyzing MARCH3-mediated polyubiquitination patterns?

Analyzing MARCH3-mediated polyubiquitination requires specialized techniques to capture these often transient modifications:

TechniqueMethodologyApplicationsCritical Controls
Linkage-specific IPUse antibodies recognizing K48/K63 chainsDetermine chain topologyInclude chain-type controls
Tagged ubiquitin expressionTransfect cells with linkage-specific Ub mutantsCellular ubiquitination assaysExpress at physiological levels
MS-based approachesSILAC with ubiquitin remnant profilingIdentify modification sitesInclude unmodified peptide controls
In vitro reconstitutionPurified components for direct assaysConfirm enzyme-substrate relationshipsTest catalytically inactive mutants

Research has shown that MARCH3 promotes K48- and K63-linked polyubiquitination of IL-6Rα and K48-linked polyubiquitination of gp130 . In mammalian overexpression systems, wild-type MARCH3, but not catalytically inactive mutants (C71S, C74S, C87S), enhances polyubiquitination of these substrates . When analyzing polyubiquitination, always include deubiquitinase inhibitors in lysates and perform reactions under denaturing conditions to preserve modifications and eliminate non-specific interactions.

How do I establish a MARCH3 knockout cell line using CRISPR-Cas9 technology?

Creating a MARCH3 knockout cell line using CRISPR-Cas9 requires careful planning and validation:

  • Guide RNA design:

    • Target early exons of MARCH3 to maximize knockout efficiency

    • Prioritize conserved exons present in all known splice variants

    • Design 2-3 gRNAs targeting exons encoding critical functional domains (RING-CH domain)

    • Use computational tools (CRISPOR, CHOPCHOP) to identify gRNAs with high on-target and low off-target scores

  • CRISPR-Cas9 delivery and selection:

    • Choose appropriate delivery method: plasmid transfection, lentiviral transduction, or RNP complex

    • Co-express selection marker (puromycin resistance) or fluorescent protein

    • For complete gene deletion, design two gRNAs flanking the gene and screen for deletion

  • Clone isolation and verification:

    • Isolate single cells by limiting dilution or FACS sorting

    • Verify knockouts by sequencing target region and Western blotting

    • Perform functional assays (assessment of IL-6Rα and gp130 stability)

    • Generate rescue cell lines by re-expressing wild-type MARCH3 in knockout cells

When using CRISPR-Cas9 for gene knockout, one consideration is that some cells may express the target gene by exon skipping or using alternative splicing . To avoid this, consider strategies that delete the entire gene or critical functional domains rather than creating small indels in a single exon.

What are the known substrates for MARCH3-mediated ubiquitination?

Based on current research, confirmed substrates of MARCH3 include:

SubstrateUbiquitination TypeFunctional ConsequenceValidation Method
IL-6RαK48-linked and K63-linked polyubiquitinationDegradation, altered traffickingIP-Western with linkage-specific antibodies
gp130K48-linked polyubiquitinationProteasomal degradationOverexpression and knockout studies

MARCH3 promotes both K48-linked and K63-linked polyubiquitination of IL-6Rα, targeting it for degradation . This ubiquitination is enhanced following IL-6 stimulation, suggesting MARCH3 participates in a negative feedback mechanism to limit IL-6 signaling. Additionally, MARCH3 mediates K48-linked polyubiquitination of gp130, a critical signal-transducing component of the IL-6 receptor complex .

Although not directly confirmed as ubiquitination substrates, MARCH3 activity also influences junction proteins in endothelial cells, particularly through regulation of occludin (OCLN) expression . This effect appears to be mediated via the FoxO1 transcription factor pathway rather than direct ubiquitination.

What experimental controls are essential when studying MARCH3 ubiquitination activity?

When investigating MARCH3 ubiquitination activity, proper controls ensure reliable results:

Control TypeSpecific ControlPurposeImplementation
Negative ControlsMARCH3 RING domain mutants (C71S, C74S, C87S)Verify E3 ligase activity dependenceExpress mutants alongside wild-type
E1/E2 enzyme omissionConfirm complete cascade requirementRemove components from in vitro reactions
Positive ControlsKnown MARCH3 substratesValidate assay functionalityInclude IL-6Rα, gp130
Specificity ControlsOther MARCH family membersDetermine enzyme specificityTest related E3 ligases
Ubiquitin mutants (K48R, K63R)Characterize chain linkage specificityUse mutants unable to form specific linkages
Technical ControlsProtease/DUB inhibitorsPreserve ubiquitination statusInclude complete inhibitor cocktails

Research has demonstrated that wild-type MARCH3, but not catalytically inactive C71S, C74S, or C87S mutants, decreases the levels of IL-6Rα and gp130 and enhances their polyubiquitination . These controls are crucial for distinguishing genuine MARCH3-mediated ubiquitination from experimental artifacts and establishing the specificity of observed effects.

What are the best approaches to study the relationship between MARCH3 and endothelial barrier function?

To effectively investigate MARCH3's role in endothelial barrier function, employ a multi-disciplinary approach:

  • Cell model selection:

    • Use physiologically relevant endothelial cells (HUVECs or hCMEC)

    • Consider organ-specific endothelial cells for tissue-specific barriers

  • MARCH3 manipulation:

    • Generate MARCH3 knockdown models using siRNA

    • Create CRISPR-Cas9 knockout endothelial cell lines

    • Establish cell lines expressing wild-type or catalytically inactive MARCH3 mutants

  • Junction protein analysis:

    • Quantify protein and mRNA levels of key junction components

    • Perform immunofluorescence microscopy to visualize junction integrity

    • Use proximity ligation assays to examine protein-protein interactions

  • Signaling pathway investigation:

    • Analyze FoxO1 phosphorylation and nuclear localization

    • Investigate PI3K/Akt pathway activation, which regulates FoxO1

    • Perform ChIP to assess FoxO1 binding to junction protein promoters

  • Functional barrier assessments:

    • Measure transendothelial electrical resistance (TEER)

    • Perform permeability assays using fluorescent tracers

    • Assess barrier recovery after permeability-inducing agents

Research has shown that MARCH3 silencing leads to upregulation of the tight junction-encoding gene occludin (OCLN) and strengthening of cell-cell contacts in endothelial cells . The molecular mechanism appears to involve inactivation of the FoxO1 forkhead transcription repressor in the absence of MARCH3, providing a link between MARCH3 and barrier integrity signaling pathways .

What phenotypic changes are observed following MARCH3 knockout or knockdown?

MARCH3 depletion produces distinct phenotypic changes depending on cell type and context:

Cell TypeMolecular ChangesFunctional Phenotypes
HeLa cells↑ IL-6Rα and gp130 levels
↑ STAT3 phosphorylation
↑ STAT3 target genes
Amplified response to IL-6/OSM stimulation
TF-1 cells↓ IL-6-induced polyubiquitination of IL-6Rα and gp130Prolonged cytokine signaling
Endothelial cells↑ Occludin (OCLN) gene expression
Inactivation of FoxO1
Strengthened cell-cell contacts
Enhanced barrier protection
Colorectal cancerCorrelation between MARCH3 downregulation and cancerPotential tumor progression

In signaling-focused studies, MARCH3 depletion enhances cytokine responses through receptor stabilization . In barrier function studies, MARCH3 knockdown strengthens cell junctions through transcriptional mechanisms . These distinct phenotypes suggest MARCH3 functions as a multifaceted regulator whose primary role varies depending on cellular context.

How can contradictory data regarding MARCH3 expression in different cancer types be reconciled?

Reconciling contradictory findings regarding MARCH3 expression across cancer types requires a systematic approach:

  • Context-dependent roles:

    • Evaluate MARCH3 expression in relation to specific signaling pathways

    • Consider whether MARCH3 functions as a tumor suppressor or oncogene depending on dominant pathways

    • Examine cellular origin and baseline MARCH3 expression in corresponding normal tissues

  • Technical considerations:

    • Compare methodologies used across studies (qPCR vs. Western blot vs. IHC)

    • Assess antibody specificity and isoform detection

    • Evaluate whether studies examined mRNA or protein expression

  • Disease stage analysis:

    • Stratify cancer samples by stage and grade

    • Separate primary tumors from metastatic samples

    • Consider temporal dynamics during cancer progression

Research suggests that downregulation of MARCH3 correlates with colorectal cancer pathogenesis and other cancer types, suggesting a potential tumor suppressor role . By systematically addressing these aspects, researchers can develop a more nuanced understanding of how MARCH3 functions across different cancer contexts, potentially revealing tissue-specific or pathway-specific roles.

What are the recommended experimental designs for studying MARCH3 in various research contexts?

Different research questions about MARCH3 require tailored experimental approaches:

Research ContextExperimental DesignKey MethodsExpected Outcomes
Signaling pathway regulationPre-experimental design with one-group pretest-posttestCytokine stimulation before/after MARCH3 manipulationDetermine effect on signal amplitude and duration
Ubiquitination substrate identificationTrue experimental design with posttest-only controlIP-MS comparing WT vs. CRISPR KO cellsGenerate list of putative substrates
Endothelial barrier functionQuasi-experimental researchTEER measurements, permeability assaysQuantify barrier strength differences
MARCH3 in disease modelsSolomon four-group designInclude disease model with/without MARCH3 manipulationDetermine prophylactic and therapeutic effects

When studying complex signaling pathways like IL-6/STAT3 activation, researchers should consider experimental approaches that account for temporal dynamics. For example, a pretest-posttest design allows comparison of cytokine-induced signaling before and after MARCH3 manipulation, capturing both immediate and delayed effects . For endothelial barrier studies, quasi-experimental designs can be applied, as they accommodate the intrinsic variability in primary endothelial cell responses .

What are emerging areas of MARCH3 research with therapeutic potential?

Given MARCH3's roles in cytokine signaling and endothelial barrier function, several promising research directions emerge:

  • Inflammatory disease applications:

    • Explore MARCH3 modulation for conditions with excessive IL-6 signaling (rheumatoid arthritis, inflammatory bowel disease)

    • Investigate MARCH3's role in acute and chronic inflammatory responses

    • Develop strategies to enhance or inhibit MARCH3 activity in specific tissues

  • Vascular barrier therapeutics:

    • Target MARCH3 to strengthen endothelial barriers in conditions with increased vascular permeability

    • Explore applications in stroke, sepsis, and ARDS where barrier dysfunction is pathogenic

    • Develop tissue-specific MARCH3 modulators for localized barrier enhancement

  • Cancer therapeutics:

    • Investigate MARCH3 restoration approaches in cancers where it is downregulated

    • Explore combinations with existing therapies targeting the IL-6/STAT3 axis

    • Develop biomarkers based on MARCH3 expression or activity patterns

  • Tool development:

    • Create small molecule inhibitors or activators of MARCH3

    • Develop engineered MARCH3 variants with altered substrate specificity

    • Generate conditional knockout mouse models for tissue-specific studies

Research has shown that MARCH3 downregulation correlates with the pathogenesis of colorectal cancer and other cancer types , suggesting potential therapeutic applications. Additionally, MARCH3's role in endothelial barrier function opens possibilities for vascular-targeted therapies in conditions characterized by barrier dysfunction.

What critical factors should be considered when establishing MARCH3 as a therapeutic target?

Establishing MARCH3 as a therapeutic target requires careful consideration of several factors:

ConsiderationKey QuestionsExperimental Approaches
Target validationIs MARCH3 causally linked to disease pathogenesis?Genetic models, correlation studies in patient samples
Tissue specificityHow does MARCH3 function differ across tissues?Conditional knockout models, tissue-specific expression analysis
Pathway redundancyCan other MARCH family members compensate?Combined knockdown studies, substrate specificity analysis
Intervention strategiesInhibition or activation? Direct or indirect?Small molecule screens, structure-based drug design
Predictive biomarkersWhat patient populations might benefit?Expression correlation, genetic association studies
Potential side effectsWhat physiological processes depend on MARCH3?Long-term knockout phenotyping, multi-organ analysis

Research has demonstrated that MARCH3 regulates critical physiological processes including cytokine signaling and endothelial barrier function . Therefore, therapeutic targeting strategies must carefully consider tissue-specific effects and potential compensatory mechanisms. Given MARCH3's apparent tumor suppressor function in some contexts , activation strategies might be preferred for cancer applications, while inhibition might benefit certain inflammatory conditions with excessive cytokine signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.