Recombinant Mouse E3 ubiquitin-protein ligase MARCH4 (41337)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Marchf4; Kiaa1399; March4; E3 ubiquitin-protein ligase MARCHF4; Membrane-associated RING finger protein 4; Membrane-associated RING-CH protein IV; MARCH-IV; RING-type E3 ubiquitin transferase MARCHF4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-409
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
March4
Target Protein Sequence
WYSCGLCTPAPQMLRHQGLLKCRCRMLFNDLKVFLLRRPPPAPLPMHGDPQLPGVAANNN TLPALGAGGWAGWRGPREAVGRETPPLPPPPPLPPSGDDDWDGPATGPPASLLSSASSDE FCKEKTEDCYSLGSSLDSGMRTPLCRICFQGPEQGELLSPCRCDGSVKCTHQPCLIKWIS ERGCWSCELCYYKYHVIAISTKNPLQWQAISLTVIEKVQIAAAILGSLFLIASISWLIWS TFSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIIHEGPSVYRIFKRWQAVNQQWKVLNYD KTKDLEDQKSGGRTNLQTSSSAQANLPSAEEEAASPPAREEGPTRAASHPSGPVSQHHCA YTILHILSHLRPHDQRSTQGSGRELVMRVTTV
Uniprot No.

Target Background

Function

MARCH4 is an E3 ubiquitin-protein ligase mediating the ubiquitination of MHC-I and CD4. This action promotes their endocytosis and lysosomal sorting via multivesicular bodies. As an E3 ubiquitin ligase, MARCH4 accepts ubiquitin from an E2 ubiquitin-conjugating enzyme (as a thioester) and directly transfers it to target substrates.

Database Links
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is MARCH4 and how does it function in the ubiquitination pathway?

MARCH4 (Membrane-Associated RING-CH-type finger 4) is a member of the MARCH family of E3 ubiquitin ligases. It contains a characteristic C4HC3-type RING domain that differs from classic C3HC4-type RING domains in the identities of the fourth and fifth coordinating residues and the length of peptide segments between them . As an E3 ligase, MARCH4 functions by facilitating the transfer of ubiquitin from an E2 conjugating enzyme to specific substrate proteins. MARCH4 particularly mediates monoubiquitination of MHC-I molecules, leading to their endocytosis from the cell surface and subsequent degradation . This process represents a key regulatory mechanism in protein trafficking and immune response modulation.

How does MARCH4 differ from other members of the MARCH family?

While all MARCH proteins share the RING-CH domain structure and function as E3 ubiquitin ligases, MARCH4 exhibits distinct substrate specificity and cellular localization patterns. Unlike MARCH1 and MARCH8, which primarily target MHC-II molecules, MARCH4 predominantly targets MHC-I for monoubiquitination . MARCH proteins have a common domain organization as type III transmembrane proteins, with the conserved N-terminus containing the RING-CH domain followed by two membrane passages and a C-terminal domain . The specific substrates targeted by different MARCH proteins vary, with MARCH4 showing distinct preferences compared to family members like MARCH1, MARCH2, or MARCH9, despite their structural similarities.

What is the evolutionary significance of MARCH4 compared to viral MARCH-like proteins?

MARCH proteins, including MARCH4, were originally identified as mammalian structural homologs of viral immunosuppressive membrane ubiquitin ligases K3 and K5 from Kaposi's sarcoma-associated herpesvirus (KSHV) . This evolutionary relationship suggests that MARCH4 shares functional mechanisms with these viral proteins that down-regulate surface expression of MHC-I molecules . The structural and functional similarities between mammalian MARCH4 and viral ligases indicate a potential evolutionary convergence or divergence in mechanisms for immune evasion and regulation. This relationship provides valuable insights into how both viral and mammalian systems have evolved to modulate immune surveillance through protein degradation pathways.

What are the key structural domains of recombinant mouse MARCH4 and how do they contribute to its function?

Recombinant mouse MARCH4 contains several key structural elements that define its function:

  • RING-CH Domain: The N-terminal C4HC3-type RING domain contains characteristically spaced conserved cysteine and histidine residues that form a zinc-binding cross-brace structure . This domain is essential for E3 ligase activity as it facilitates the interaction with E2 ubiquitin-conjugating enzymes.

  • Transmembrane Domains: MARCH4, like other MARCH proteins, contains multiple transmembrane domains that anchor it within cellular membranes. These domains determine the protein's subcellular localization and orientation.

  • Cytosolic Domains: Both N- and C-terminal domains face the cytosol, allowing the RING-CH domain to interact with cytosolic ubiquitination machinery components .

This structural arrangement enables MARCH4 to function as a membrane-associated E3 ligase that recognizes specific transmembrane protein substrates and facilitates their ubiquitination.

How does the substrate recognition mechanism of MARCH4 work?

The substrate recognition mechanism of MARCH4 likely involves:

  • Proximity-Based Recognition: Similar to other MARCH proteins, MARCH4 may utilize a proximity model where adaptor proteins help position the E3 ligase near its substrate . This model explains how MARCH4 can target diverse substrates without requiring specific sequence similarity.

  • Transmembrane Domain Interactions: The transmembrane regions of MARCH4 likely interact with transmembrane domains of substrate proteins, facilitating specific recognition.

  • Post-Translational Modification Sensing: MARCH4 may recognize specific post-translational modifications or conformational states of its substrates, similar to how other MARCH proteins identify their targets.

This multi-faceted recognition system enables precise targeting of substrates like MHC-I for monoubiquitination while maintaining specificity in the crowded cellular environment.

What are the optimal conditions for expressing and purifying recombinant mouse MARCH4?

For optimal expression and purification of recombinant mouse MARCH4:

Expression System Selection:

  • Mammalian Expression Systems: HEK293 or CHO cells are recommended due to the membrane-associated nature of MARCH4 and the need for proper post-translational modifications.

  • Expression Vectors: Vectors containing strong promoters (CMV) and appropriate tags (His, FLAG, or GST) for detection and purification.

Expression Conditions:

  • Temperature: 30-32°C rather than 37°C to reduce protein aggregation

  • Induction Time: 24-48 hours for mammalian systems

  • Cell Lysis: Gentle detergent-based methods using non-ionic detergents (e.g., 1% Triton X-100 or 1% NP-40)

Purification Protocol:

  • Solubilize membrane fractions with appropriate detergents

  • Affinity chromatography using tag-specific resins

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for final polishing

Critical Parameters:

  • Maintain detergent concentration above critical micelle concentration throughout purification

  • Include protease inhibitors and reducing agents to prevent degradation

  • Verify protein activity through in vitro ubiquitination assays

What are the most effective experimental approaches to study MARCH4-substrate interactions?

Several complementary approaches can effectively study MARCH4-substrate interactions:

In Vitro Methods:

  • Pull-down Assays: Using purified MARCH4 (or fragments) with potential substrate proteins to identify direct interactions.

  • Surface Plasmon Resonance (SPR): For quantifying binding kinetics and affinity between MARCH4 and substrates.

  • In Vitro Ubiquitination Assays: Reconstituting the ubiquitination reaction with purified E1, E2, MARCH4, and substrate proteins to verify enzymatic activity.

Cellular Methods:

  • Co-immunoprecipitation: To identify protein complexes containing MARCH4 and potential substrates.

  • Proximity Ligation Assays: For visualizing protein-protein interactions in intact cells.

  • FRET/BRET Analysis: To study dynamic interactions between MARCH4 and substrates.

Substrate Identification Methods:

  • Proteomics Approaches: Comparing ubiquitinated proteomes in wild-type versus MARCH4-knockout or overexpressing cells.

  • Yeast Two-Hybrid Screening: To identify novel interacting partners.

  • BioID or APEX Proximity Labeling: For identifying proteins in close proximity to MARCH4 in living cells.

These methodologies should be used in combination to provide comprehensive insights into MARCH4-substrate interactions.

How can researchers effectively monitor MARCH4-mediated ubiquitination in cellular systems?

Monitoring MARCH4-mediated ubiquitination requires specialized techniques:

Detection of Ubiquitinated Substrates:

  • Western Blotting: Using antibodies against the substrate protein to detect mobility shifts caused by ubiquitination.

  • Immunoprecipitation followed by Ubiquitin Blotting: Pull down the substrate protein and probe with anti-ubiquitin antibodies.

  • Tandem Ubiquitin Binding Entities (TUBEs): Use ubiquitin-binding domains to enrich ubiquitinated proteins before analysis.

Live-Cell Monitoring:

  • Fluorescent Ubiquitin Constructs: Express fluorescently tagged ubiquitin to visualize ubiquitination events.

  • Fluorescent Timers: Use unstable fluorescent proteins fused to substrates to monitor degradation rates.

  • Surface Biotinylation Assays: To track internalization of cell surface proteins (e.g., MHC-I) following MARCH4-mediated ubiquitination.

Quantitative Analysis:

  • Flow Cytometry: For measuring changes in surface expression of MARCH4 substrates.

  • Pulse-Chase Experiments: To determine the turnover rates of substrates in the presence or absence of MARCH4.

  • Mass Spectrometry: For site-specific identification of ubiquitination and quantification of ubiquitin chain types.

These approaches provide complementary data on MARCH4 activity, substrate specificity, and the consequences of ubiquitination.

How does MARCH4 contribute to immune response regulation, and what are the implications for immunological research?

MARCH4 plays significant roles in immune regulation through several mechanisms:

MHC-I Regulation:
MARCH4 monoubiquitinates MHC-I molecules, leading to their endocytosis from the cell surface and subsequent degradation . This process directly affects antigen presentation to CD8+ T cells, potentially modulating cytotoxic immune responses. By controlling MHC-I surface expression, MARCH4 may influence T cell activation thresholds and immune surveillance.

Implications for Research:

  • Cancer Immunotherapy: MARCH4 inhibition could potentially enhance tumor antigen presentation, making it a target for improving immunotherapeutic approaches.

  • Viral Immunity: Understanding MARCH4 function may provide insights into how viruses evade immune detection, as MARCH4 shares functional similarities with viral immunoevasins like K3 and K5 .

  • Autoimmunity Research: Dysregulation of MARCH4 could contribute to aberrant antigen presentation associated with autoimmune disorders.

  • Transplantation Biology: MARCH4 manipulation might help modulate graft rejection responses by altering MHC-I presentation.

Researchers investigating these areas should consider MARCH4 as a potential regulatory node in immune response pathways.

How do MARCH4 knockout or overexpression models affect cellular physiology and immune function?

MARCH4 Knockout Effects:

  • Increased MHC-I Surface Expression: Based on MARCH4's known function, knockout models likely show elevated MHC-I surface levels due to reduced ubiquitination-mediated endocytosis .

  • Enhanced Antigen Presentation: Higher MHC-I levels potentially lead to improved antigen presentation to CD8+ T cells.

  • Altered Immune Responses: Knockout mice may demonstrate heightened CD8+ T cell responses to viral infections or tumor challenges.

  • Potential Compensatory Mechanisms: Other MARCH family members might show altered expression to compensate for MARCH4 loss.

MARCH4 Overexpression Effects:

  • Reduced MHC-I Surface Expression: Excessive MARCH4 likely causes dramatic reduction in surface MHC-I levels .

  • Impaired Antigen Presentation: Reduced MHC-I leads to compromised CD8+ T cell activation.

  • Immune Evasion Phenotype: Similar to viral immune evasion strategies, potentially promoting persistence of intracellular pathogens.

  • Stress Response Alterations: Possible impact on ER stress pathways due to altered protein trafficking.

These models provide valuable tools for dissecting MARCH4 function in different physiological contexts and understanding its role in immune homeostasis.

What are the most promising research directions for studying MARCH4 in relation to disease pathogenesis?

Several promising research directions emerge for MARCH4 in disease contexts:

Infectious Diseases:

  • Viral Immune Evasion: Exploring how viruses might manipulate MARCH4 to downregulate MHC-I and escape immune detection.

  • Bacterial Infections: Investigating whether intracellular bacteria affect MARCH4 function to modulate host immune responses.

Cancer Biology:

  • Tumor Immune Evasion: Examining MARCH4 expression in different cancer types and its correlation with MHC-I levels and cytotoxic T cell infiltration.

  • Therapeutic Targeting: Developing small molecule inhibitors or degraders of MARCH4 to enhance tumor antigen presentation.

  • Biomarker Potential: Evaluating MARCH4 expression as a prognostic indicator or predictor of immunotherapy response.

Autoimmune Disorders:

  • Dysregulated Antigen Presentation: Investigating MARCH4 variants or expression abnormalities in autoimmune conditions.

  • Therapeutic Modulation: Exploring MARCH4 activators to reduce excessive antigen presentation in autoimmunity.

Neurodegenerative Diseases:

  • Protein Quality Control: Studying MARCH4's potential role in clearing misfolded proteins implicated in neurodegenerative disorders.

  • Neuroinflammation: Examining how MARCH4-mediated immune regulation affects neuroinflammatory processes.

These directions represent high-impact areas where MARCH4 research could significantly advance our understanding of disease mechanisms and therapeutic approaches.

How can researchers address inconsistent results in MARCH4 ubiquitination assays?

Inconsistent results in MARCH4 ubiquitination assays can stem from multiple factors:

Common Issues and Solutions:

IssuePotential CausesTroubleshooting Strategies
Low ubiquitination activity- Inactive MARCH4 protein
- Suboptimal E2 enzyme
- Improper reaction conditions
- Verify MARCH4 expression/purification by Western blot
- Test multiple E2 enzymes (UbcH5 family recommended)
- Optimize buffer conditions (pH 7.5-8.0, include Zn²⁺)
- Ensure reducing conditions (1-5mM DTT)
High background- Autoubiquitination of MARCH4
- Non-specific antibody binding
- Contaminating E3 ligases
- Include negative controls (catalytically dead MARCH4)
- Use more specific antibodies
- Improve purification protocol with additional chromatography steps
Poor substrate ubiquitination- Incorrect substrate preparation
- Wrong subcellular fraction
- Interfering post-translational modifications
- Ensure proper substrate folding/membrane incorporation
- Isolate appropriate cellular fractions (membrane vs. cytosolic)
- Dephosphorylate substrates if necessary
Variable results between experiments- Inconsistent protein quality
- Temperature fluctuations
- Unstable reagents
- Establish strict quality control for recombinant proteins
- Maintain consistent temperature throughout procedures
- Prepare fresh ubiquitin stocks for each experiment
- Aliquot and store enzymes appropriately

Validation Approaches:

  • Use catalytically inactive MARCH4 mutants (mutations in the RING domain) as negative controls

  • Confirm results with both in vitro and cellular assays

  • Verify substrate specificity with multiple independent methods

How should researchers interpret conflicting data on MARCH4 substrate specificity?

Conflicting data on MARCH4 substrate specificity requires careful interpretation:

Analytical Framework:

  • Evaluate Experimental Context:

    • Cell/tissue type differences may explain varying substrate preferences

    • Expression levels of MARCH4 can affect apparent specificity

    • Presence of competing E3 ligases or deubiquitinating enzymes may influence results

  • Assess Technical Approaches:

    • Direct (in vitro ubiquitination) vs. indirect (cell-based) evidence

    • Overexpression artifacts vs. physiological expression levels

    • Sensitivity and specificity of detection methods

  • Consider Regulatory Factors:

    • Post-translational modifications of MARCH4 may alter substrate preferences

    • Accessory proteins or adaptors might confer context-dependent specificity

    • Subcellular localization differences can restrict access to certain substrates

Resolution Strategies:

  • Perform targeted validation experiments in identical systems

  • Use complementary approaches (genetics, biochemistry, imaging)

  • Develop quantitative assays to measure relative substrate preferences

  • Consider substrate competition experiments to assess hierarchical preferences

When interpreting conflicting data, maintain awareness that MARCH4 may have context-dependent substrate specificity influenced by cellular conditions and expression levels.

What are the key considerations when designing CRISPR/Cas9 experiments to study MARCH4 function?

Designing effective CRISPR/Cas9 experiments for MARCH4 requires careful planning:

Guide RNA Design:

  • Target Selection:

    • Target conserved exons encoding the RING-CH domain for complete loss of function

    • Consider targeting transmembrane domains for altered localization studies

    • Avoid regions with homology to other MARCH family members

  • Off-Target Prediction:

    • Use multiple prediction algorithms to identify potential off-target sites

    • Select guides with minimal predicted off-targets, especially in other MARCH genes

    • Design at least 3-4 independent gRNAs per experiment to control for off-target effects

Experimental Controls:

  • Validation Controls:

    • Non-targeting gRNA controls

    • Rescue experiments with CRISPR-resistant MARCH4 constructs

    • Phenotype comparison with siRNA knockdown approaches

  • Functional Verification:

    • Confirm knockout at protein level (not just genomic DNA sequencing)

    • Verify loss of ubiquitination activity using known substrates

    • Assess MHC-I surface levels as a functional readout

Advanced Design Considerations:

  • Knockin Strategies:

    • Consider epitope tagging of endogenous MARCH4 for tracking

    • Design point mutations in catalytic residues for separation-of-function studies

    • Create fluorescent reporter fusions for live-cell imaging

  • Timing and Systems:

    • For developmental studies, consider inducible CRISPR systems

    • In immune cells, account for activation state when interpreting results

    • For tissue-specific studies, use appropriate Cas9 delivery methods

These considerations will help researchers design robust CRISPR experiments that yield reliable insights into MARCH4 function while minimizing technical artifacts and misinterpretation.

What emerging technologies could advance our understanding of MARCH4 biology?

Several cutting-edge technologies show promise for MARCH4 research:

  • Cryo-Electron Microscopy: Structural determination of MARCH4-substrate complexes could provide unprecedented insights into recognition mechanisms and conformational changes during ubiquitin transfer.

  • Proximity Proteomics: BioID, APEX, or TurboID approaches can identify the complete MARCH4 interactome in different cellular contexts, revealing adaptors, regulators, and substrates.

  • Single-Cell Multi-omics: Integrating transcriptomics, proteomics, and ubiquitinomics at single-cell resolution can reveal cell-specific roles of MARCH4 in heterogeneous tissues.

  • Optogenetic Control Systems: Light-inducible MARCH4 activation could enable precise temporal control of ubiquitination, revealing kinetics of substrate degradation.

  • CRISPR Screening with Ubiquitination Reporters: High-throughput screens using fluorescent ubiquitination reporters could identify novel regulators of MARCH4 activity.

  • Advanced Imaging Techniques: Super-resolution microscopy combined with split fluorescent protein approaches can visualize MARCH4-substrate interactions in real-time within cellular microdomains.

These technologies promise to overcome current limitations in studying membrane-associated E3 ligases and their dynamic functions in complex cellular environments.

How might artificial intelligence and computational approaches enhance MARCH4 research?

AI and computational methods offer powerful tools for advancing MARCH4 research:

  • Substrate Prediction Algorithms:

    • Machine learning models trained on known E3-substrate pairs can predict novel MARCH4 substrates

    • Structural modeling of transmembrane protein interactions can identify potential recognition motifs

  • Network Analysis:

    • Systems biology approaches can place MARCH4 within larger ubiquitination networks

    • Pathway analysis can reveal unexpected connections between MARCH4 and disease-relevant processes

  • Molecular Dynamics Simulations:

    • Modeling MARCH4-substrate interactions and ubiquitin transfer mechanisms

    • Predicting effects of mutations on MARCH4 structure and function

  • Drug Discovery Applications:

    • Virtual screening for MARCH4 inhibitors or activators

    • Design of peptide-based inhibitors targeting specific MARCH4-substrate interfaces

  • Data Integration Platforms:

    • AI-driven literature mining to synthesize fragmented knowledge about MARCH proteins

    • Multi-omics data integration to identify context-dependent roles of MARCH4

These computational approaches can generate testable hypotheses, prioritize experiments, and accelerate discovery in MARCH4 biology.

What are the potential therapeutic applications of modulating MARCH4 activity?

Modulating MARCH4 activity holds therapeutic potential across multiple disease areas:

Immunotherapy Enhancement:

  • Inhibiting MARCH4 could increase MHC-I surface expression on tumor cells, enhancing recognition by cytotoxic T cells and improving response to checkpoint inhibitors.

  • Combination approaches targeting multiple immune evasion mechanisms including MARCH4 could overcome resistance to current immunotherapies.

Infectious Disease Treatment:

  • Targeting MARCH4 could counteract viral strategies that exploit this pathway for immune evasion.

  • Modulating MARCH4 might enhance clearance of intracellular pathogens through improved antigen presentation.

Autoimmune Disease Intervention:

  • Selectively activating MARCH4 in specific cell types could reduce excessive antigen presentation in autoimmune conditions.

  • Temporal control of MARCH4 activity might help modulate acute inflammatory flares.

Transplantation Medicine:

  • Controlled upregulation of MARCH4 in transplanted tissues could reduce graft immunogenicity.

  • Donor organ treatment strategies targeting MARCH4 might improve transplant outcomes.

Technical Challenges and Solutions:

  • Developing membrane-permeable inhibitors for intracellular E3 ligases

  • Achieving cell-type specificity through antibody-drug conjugates or targeted nanoparticles

  • Creating small-molecule modulators specific to MARCH4 versus other MARCH family members

These therapeutic directions represent promising frontiers in translating MARCH4 basic science into clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.