Recombinant Mouse E3 ubiquitin-protein ligase RNF149 (Rnf149)

Shipped with Ice Packs
In Stock

Description

Overview of RNF149

Rnf149, or Ring Finger Protein 149, is an E3 ubiquitin ligase. E3 ubiquitin ligases are enzymes that facilitate the transfer of ubiquitin to specific protein substrates, a process known as ubiquitination. Ubiquitination plays a critical role in various cellular processes, including protein degradation, signal transduction, and DNA repair . RNF149 has been identified as a key regulator in the inflammatory response and cardiac repair following myocardial infarction (MI) .

Role in Myocardial Infarction

Research indicates that RNF149 plays a significant role in modulating the inflammatory response during myocardial infarction . Infiltrated macrophages, RNF149 restricts inflammation by promoting ubiquitylation-dependent proteasomal degradation of IFNGR1 . Studies using RNF149 knockout (KO) mice have revealed that the absence of RNF149 exacerbates ischemic myocardial injury and impairs post-infarction cardiac repair . Specifically, RNF149 deficiency leads to:

  • Increased infarct size

  • Elevated myocardial apoptosis

  • Reduced collagen density in the infarct area, indicating impaired scar formation

3.1. Impact on Inflammatory Response

RNF149 influences the inflammatory response by targeting IFNGR1, a receptor for interferon-gamma (IFNγ). By promoting the degradation of IFNGR1, RNF149 destabilizes it in macrophages, which helps to dampen the inflammatory signaling . This mechanism is crucial for preventing hyperactive inflammatory responses that can exacerbate cardiac injury following MI .

3.2. Impact on Cardiac Repair

The absence of RNF149 impairs the normal post-infarction cardiac repair processes. Reduced collagen deposition in the infarct area of RNF149KO mice suggests that RNF149 is involved in promoting proper scar formation, which is essential for maintaining the structural integrity of the heart after MI .

Interaction with IFNGR1

RNF149 interacts with IFNGR1, a receptor for interferon-gamma (IFNγ), which is a critical component of the JAK-STAT signaling pathway and cytokine-cytokine receptor interaction .

  • Co-immunoprecipitation Experiments: Confirmed the interaction between RNF149 and IFNGR1 .

  • PA Domain Essential for Interaction: The protease-associated (PA) domain (67-175 amino acids) of RNF149 is essential for its interaction with IFNGR1 .

  • Minimal Impact on mRNA Levels: The mRNA levels of interacting protein candidates remain minimally altered in RNF149KO infarcted hearts .

RNF149 in Cancer

RNF149 has been implicated in the progression of hepatocellular carcinoma (HCC) . It promotes the proliferation, migration, and invasion of HCC cells through its E3 ubiquitin ligase activity .

RNF168: Another E3 Ubiquitin Ligase

RNF168, another E3 ubiquitin ligase, plays a regulatory role in the repair of double-strand DNA breaks . It is also a key regulator of cell survival and proliferation . RNF168 is an important component of the mechanisms controlling cell fate in both human and mouse hematopoietic growth factor-dependent cells, as well as in the human breast epithelial cell line MCF-7 .

RNF213: Another E3 Ubiquitin Ligase

Ring finger protein 213 (RNF213) is a large E3 ubiquitin ligase associated with moyamoya disease . It contains a C3HC4-type RING finger domain with an E3 ubiquitin ligase domain and six AAA+ adenosine triphosphatase (ATPase) domains . RNF213 functions as a K63-linked E3 ubiquitin ligase and has the ability to form various types of ubiquitin chains, including M1, K11, K48, and K63, depending on the specific pathogens involved .

Tables Summarizing Key Findings

FeatureDescription
Protein TypeE3 ubiquitin ligase
FunctionRegulates protein degradation, signal transduction, and DNA repair via ubiquitination
Role in MIRestricts inflammation by promoting ubiquitylation-dependent proteasomal degradation of IFNGR1 in macrophages; absence exacerbates ischemic myocardial injury and impairs post-infarction cardiac repair
InteractionInteracts with IFNGR1 through its protease-associated (PA) domain (amino acids 67-175)
Impact of DeficiencyIncreased infarct size, elevated myocardial apoptosis, and reduced collagen density in the infarct area
Role in CancerPromotes proliferation, migration, and invasion of HCC cells

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rnf149; Greul4; E3 ubiquitin-protein ligase RNF149; Goliath-related E3 ubiquitin-protein ligase 4; RING finger protein 149; RING-type E3 ubiquitin transferase RNF149
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-394
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Rnf149
Target Protein Sequence
GALEWYSAMVSIEYVDPQSNLTVWSVSESGRFGESSLREERQGLVGVPRAPAPAEGCAPD TRFVAPGALGNAPWVALVARGGCTFKDKVLAAARRNASAVVVYNLESNGNATEPMSHAGT GNIVVIMISYPKGREIFDLVQKGIPVKMRIEIGTRHMQEFISGQSVVFVAIAFITMMIIS LAWLIFYYIQRFLYTGSQFGSQNHRKETKKVIGQLPLHTVKHGEKGIDVDAENCAVCIEN FKVKDVIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGDPEDTQELPTPEAA PGRVSVGNLSVTSQDEERSESNLPSSSSSESGPHRPCLKEDAGEDTALLGAGRSEPQHGG SIC
Uniprot No.

Target Background

Function
E3 ubiquitin-protein ligase. It ubiquitinates BRAF, leading to its proteasomal degradation.
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the domain architecture of RNF149 and how does it relate to its function?

RNF149 is a type I transmembrane protein with a distinctive domain organization critical for its function. Analysis reveals RNF149 contains:

  • N-terminal signal peptide

  • Protease-associated (PA) domain (amino acids 67-175)

  • Single transmembrane domain (approximately 20 amino acids)

  • C-terminal cytosolic RING finger domain

The PA domain is essential for substrate recognition and binding, particularly for IFNGR1 interaction, while the RING domain confers E3 ubiquitin ligase activity. Studies have shown that neither the RING domain nor the catalytic site (H289) is necessary for substrate binding, but they are critical for subsequent ubiquitination . The PA domain specifically mediates interaction with wild-type BRAF but notably does not interact with mutant BRAF forms .

What cellular functions has RNF149 been implicated in?

RNF149 has multiple identified functions in cellular homeostasis:

FunctionSubstrate/PathwayBiological ImpactReference
Regulation of MAPK signalingWild-type BRAFAttenuates cell growth induced by wild-type BRAF
Immune modulationIFNGR1Controls macrophage inflammatory responses
Protein quality controlMislocalized proteinsParticipates in pre-emptive ER-associated quality control (pEQC)
Development regulationAssociated with FGF/MAPK pathwayInfluences pharyngeal muscle specification

Unlike many E3 ligases with broad substrate specificity, RNF149 shows selective activity for wild-type BRAF over mutant BRAF , suggesting a role in normal cellular homeostasis rather than in oncogenic contexts.

How can researchers effectively measure RNF149-mediated ubiquitination activity?

Measuring RNF149's ubiquitination activity requires a multi-faceted approach:

In vitro ubiquitination assay:

  • Purify recombinant RNF149 and substrate proteins (e.g., wild-type BRAF)

  • Combine with E1, E2 enzymes, ubiquitin, and ATP

  • Detect ubiquitinated products via Western blotting using substrate-specific and ubiquitin-specific antibodies

Cell-based ubiquitination analysis:

  • Co-transfect cells with tagged RNF149 and substrate (e.g., GFP-tagged wild-type BRAF with DDK-tagged RNF149)

  • Include proteasome inhibitor (MG132) in treatment groups to prevent degradation of ubiquitinated products

  • Perform immunoprecipitation followed by Western blotting to detect substrate ubiquitination

UBAIT (Ubiquitin-Activated Interaction Trap) approach:

  • Generate RNF149-ubiquitin fusion constructs to trap transient E3-substrate interactions

  • Compare wild-type and catalytically inactive (VW271/299AA mutation) RNF149UBAIT profiles

  • Identify substrates via mass spectrometry analysis of purified complexes

This approach has revealed RNF149's selective binding to non-translocated proteins and its association with known pEQC components, demonstrating specificity in its substrate recognition.

What are the most effective methods for manipulating RNF149 expression in experimental models?

Several approaches have proven effective for modulating RNF149 expression:

siRNA-mediated silencing:

  • Use siRNA duplexes targeting RNF149 (e.g., sequences: 5'-GGAAUUGUGAAAUGUAGUUCCUUAT-3', 5'-ACCUGUAAAGUGAGAAAUCUUGCCA-3', 5'-GGAAACUAAGAAGGUUAUUGGCCAG-3')

  • Transfect using Lipofectamine RNAiMAX or similar reagents

  • Validate knockdown efficiency via qPCR and Western blotting

CRISPR/Cas9-mediated gene editing:

  • Design guide RNAs targeting exonic regions of RNF149

  • For tissue-specific manipulation, use cell-type-specific promoters driving Cas9 expression

  • Validate gene disruption via sequencing and protein expression analysis

Tissue-specific manipulation in vivo:

  • Adeno-associated virus (AAV) encoding RNF149-shRNA under cell-specific promoters (e.g., F4/80 for macrophage-specific knockdown)

  • Administer via targeted delivery methods (e.g., intra-bone marrow injection for bone marrow macrophage targeting)

  • Confirm target cell-specific knockdown via qPCR

This approach was successfully employed to demonstrate that macrophage-specific RNF149 knockdown exacerbated cardiac dysfunction in mouse models of myocardial infarction .

How does RNF149 contribute to cancer progression and therapy resistance?

RNF149 plays complex roles in cancer progression through multiple mechanisms:

Hepatocellular Carcinoma (HCC):

  • Upregulated in tumor tissues

  • Correlates with poor prognosis in HCC patients

  • Promotes HCC progression through its ubiquitin ligase activity

  • DNAJC25 identified as a novel substrate in HCC context

Acute Myeloid Leukemia (AML):

  • Accelerates AML progression

  • Modifies the AML immune microenvironment

  • Triggers CD8+ T cell dysfunction

  • Influences transformation of CD8+ Navie.T cells to CD8+ T Exhausted cells

  • Contributes to diminished AML responsiveness to chemotherapeutic agents

Drug Resistance Mechanisms:

  • Significantly higher expression in drug-resistant AML cell lines (MOLM13/R and MV4-11/R) compared to parent lines

  • Enhances proliferation of drug-resistant cell lines

  • Inhibits apoptosis

  • Promotes resistance to cytarabine (Ara-C)

These findings suggest RNF149 as a potential prognostic indicator and therapeutic target for overcoming cancer drug resistance.

What is the role of RNF149 in cardiac pathology and inflammation?

RNF149 serves as a critical regulator of cardiac repair following myocardial injury:

IFNGR1 Regulation:

  • RNF149 destabilizes IFNGR1 in macrophages

  • The protease-associated (PA) domain (67-175 amino acids) mediates interaction with IFNGR1

  • This interaction is independent of the RING domain and catalytic site

Impact on Cardiac Repair:

  • RNF149 deletion increases infiltration of proinflammatory monocytes/macrophages

  • Hastens decline in reparative macrophage subsets

  • Increases myocardial apoptosis (TUNEL+ α-actinin+ cells) in border areas after MI

  • Reduces collagen I deposition and angiogenesis in infarcted areas

  • Decreases α-SMA+ myofibroblasts in infarct areas

Mechanistic Pathway:

  • RNF149 knockdown promotes Type-II IFN response in macrophages

  • Operates through STAT1-mediated feedback loop

  • RNF149-deficient macrophages show heightened expression of IL-6, IL-23a, Csf3, and MMP9

  • Reduced expression of repair factors VEGF-α and TGF-β

These findings highlight RNF149's role in balancing inflammatory and reparative responses after cardiac injury, suggesting potential therapeutic applications in modulating post-infarction healing.

How does RNF149 achieve substrate specificity, particularly in distinguishing wild-type from mutant BRAF?

RNF149 demonstrates remarkable substrate discrimination capability:

Wild-type vs. Mutant BRAF:

  • RNF149 binds directly to the C-terminal kinase-containing domain of wild-type BRAF

  • Induces ubiquitination and subsequent proteasome-dependent degradation

  • Notably does not bind to mutant BRAF or induce its ubiquitination

Structural Basis for Selectivity:

  • The PA domain mediates substrate recognition

  • Possible conformational differences between wild-type and mutant BRAF affect binding interface

  • Mutant BRAF likely adopts structural conformations that preclude RNF149 recognition

Functional Consequence:

  • RNF149 attenuates wild-type BRAF-induced cell growth

  • Lacks regulatory control over oncogenic mutant BRAF

  • This selective activity positions RNF149 as the first ubiquitin ligase shown to degrade wild-type BRAF in a proteasome-dependent manner

This specificity mechanism may represent an evolutionarily conserved quality control system that selectively degrades properly folded wild-type proteins while allowing misfolded or structurally altered mutant proteins to evade this regulatory mechanism.

What is the role of RNF149 in protein quality control pathways?

RNF149 functions as a critical component in protein quality control, particularly in the pre-emptive ER-associated quality control (pEQC) pathway:

Substrate Recognition:

  • Selectively binds non-translocated (mislocalized) proteins

  • Associates with known pEQC components

  • Functions in the recognition of polypeptides that fail to translocate into the ER

Functional Interactions:

  • Co-purifies with AIRAPL, a key pEQC component

  • Interaction is dependent on AIRAPL's ability to bind ubiquitin

  • Ubiquitin binding (UIM) mutant of AIRAPL shows diminished ability to bind RNF149

  • Interacts with translocation machinery components (Sec61, Sec62, Sec63, Sec11, Tram1)

Impact on Cellular Function:

  • Impairment in RNF149 function increases translocation flux into the ER

  • Dysfunction manifests in myeloproliferative neoplasm (MPN) phenotype

  • This pathological condition is associated with pEQC impairment

These findings position RNF149 as a critical gatekeeper in protein quality control, with implications for diseases associated with protein misfolding and improper subcellular localization.

How can RNF149 be studied in the context of immune regulation?

RNF149's emerging role in immune regulation requires specialized methodological approaches:

Immune Cell Infiltration Analysis:

  • Single-sample Gene Set Enrichment Analysis (ssGSEA) to assess immune enrichment scores

  • Evaluate specific immune cell populations (activated CD8+ T cells, exhausted T cells, M2 macrophages)

  • Generate enrichment score heatmaps using R/Bioconductor package ComplexHeatmap

  • Calculate Pearson correlations between RNF149 protein expression and immune cell infiltration

In Vivo Immune Phenotyping:

  • Flow cytometry analysis of immune cell populations in tissues (e.g., cardiac tissue post-MI)

  • Immunohistochemical quantification of specific immune cell markers

  • mRNA expression analysis of inflammatory and repair-associated genes

Functional Immune Assays:

  • Co-culture experiments with RNF149-modulated immune cells and target cells

  • Cytokine profiling of conditioned media

  • T cell activation and exhaustion marker analysis

  • Evaluation of cytotoxic activity against target cells

Research has demonstrated that RNF149 expression is associated with immunocyte infiltration and T cell functions in HCC, indicating its potential role in immune regulation of cancer microenvironments .

What approaches are effective for identifying novel RNF149 substrates?

Discovering new RNF149 substrates requires sophisticated proteomic and biochemical strategies:

Tandem Affinity Purification and Mass Spectrometry:

  • Express tagged RNF149 in target cells

  • Perform sequential purification steps to isolate RNF149 and associated proteins

  • Identify binding partners through mass spectrometry

  • This approach identified wild-type BRAF as a RNF149 interacting protein

Ubiquitin-Activated Interaction Trap (UBAIT):

  • Generate RNF149-ubiquitin fusion constructs

  • Compare substrate profiles between wild-type and catalytically inactive RNF149

  • Perform mass spectrometry analysis to identify trapped substrates

  • This approach revealed RNF149's ability to ubiquitinate known pEQC substrates

Bioinformatic Analysis of Protein Interactome:

  • Analyze protein interactome data from repositories like BioGRID

  • Perform Kyoto Encyclopedia of Genes and Genomes (KEGG) enrichment analysis

  • Use Venn diagram analysis to identify intersecting sets of RNF149-binding protein candidates

  • This approach identified IFNGR1 as a top-ranked interacting protein candidate

Validation of Novel Substrates:

  • Perform reciprocal co-immunoprecipitation experiments

  • Conduct domain mapping using truncated RNF149 constructs

  • Assess ubiquitination status of potential substrates

  • Evaluate functional consequences of substrate modification

This multi-layered approach has successfully identified several RNF149 substrates including wild-type BRAF, IFNGR1, and DNAJC25, expanding our understanding of RNF149's biological functions.

How might RNF149 be therapeutically targeted in disease contexts?

Current research suggests several potential approaches for therapeutic targeting of RNF149:

Small Molecule Inhibitors:

  • Target the RING domain to inhibit E3 ligase activity

  • Design allosteric modulators affecting substrate binding via the PA domain

  • Develop protein-protein interaction disruptors to prevent RNF149-substrate associations

Genetic Approaches:

  • Cell-type specific RNF149 modulation via AAV-delivered shRNA (demonstrated effective for macrophage-specific targeting)

  • CRISPR/Cas9-based therapeutic editing strategies

  • mRNA-based approaches to transiently modulate RNF149 levels

Context-Dependent Applications:

  • In cancer: Inhibit RNF149 to overcome therapy resistance and improve chemotherapeutic efficacy

  • In inflammatory conditions: Enhance RNF149 function to promote resolution of inflammation and tissue repair

  • In cardiac injury: Modulate RNF149 to balance inflammatory and reparative macrophage functions

The development of specific RNF149 modulators requires further structural studies and high-throughput screening efforts, representing an important frontier in E3 ligase-targeted therapeutics.

What are the challenges in cross-species research on RNF149?

Investigating RNF149 across different species presents several methodological challenges:

Sequence and Structural Variations:

  • Human RNF149 (Q8NC42) and mouse RNF149 show high but not complete homology

  • RNF149-related variants exist (e.g., Rnf149-r in some species lacks the catalytic RING domain)

  • These variations may affect substrate specificity and function

Expression Pattern Differences:

  • Developmental timing of expression varies between species

  • Tissue-specific expression patterns differ

  • Regulatory elements controlling expression show species-specific characteristics

Model System Selection:

  • Cell lines: Human (293T, MOLM13, MV4-11) vs. mouse (C18-4) systems show differences in RNF149 function

  • Animal models: Knockdown/knockout phenotypes may vary between species

  • RNF149-r (related) gene in some species functions in parallel to FGF/MAPK pathway, showing species-specific regulatory networks

Methodological Standardization:

  • Antibody cross-reactivity between species requires validation

  • siRNA/shRNA sequences effective in one species may not work in another

  • Experimental conditions (transfection efficiency, expression levels) need species-specific optimization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.