Recombinant Mouse E3 ubiquitin-protein ligase RNF152 (Rnf152)

Shipped with Ice Packs
In Stock

Description

RNF152 and Inflammatory Response

RNF152 positively regulates the TLR/IL-1R-mediated inflammatory response by facilitating the oligomerization of MyD88, which subsequently promotes the assembly of Myddosome . Studies using RNF152-deficient mice have demonstrated reduced production of inflammatory cytokines in response to lipopolysaccharide (LPS), indicating that RNF152 is essential for TLR/IL-1R-mediated, MyD88-dependent signal transduction .

RNF152 and TLR/IL-1R Signaling

RNF152 is involved in IL-1R/TLR4-mediated signaling . Knockdown of RNF152 impaired the phosphorylation of IKKα/β and p38 triggered by IL-1β and LPS, which are key indicators of the activation of these kinases .

Signaling PathwayEffect of RNF152 Deficiency
IL-1R/TLR4Impaired phosphorylation of IKKα/β and p38
MyD88-dependentReduced inflammatory cytokine production
TRIF-dependentNo significant effect

RNF152 and mTOR Signaling

RNF152 also negatively regulates mTOR signaling by targeting the small GTPase RagA . The GTP-bound active form of RagA positively regulates the mTOR signaling pathway, and RNF152 acts as a negative regulator by blocking RagA activity . Overexpression of RNF152 downregulates p-p70S6K expression, suggesting its role as a negative regulator of mTOR signaling .

RNF152 in Neuronal Development

While the aforementioned information focuses on RNF152's role in inflammation and signaling pathways, it's important not to confuse it with its homolog, RNF157, which is involved in neuronal development . RNF157 regulates neuronal survival and morphology in cultured neurons . It also ubiquitinates the adaptor protein APBB1 (amyloid beta precursor protein-binding, family B, member 1 or Fe65), influencing neuronal survival .

RNF152 and Apoptosis

Previous studies suggested that RNF152 promotes apoptosis . RNF157, a homolog of RNF152, regulates neuronal survival, and its ligase activity is crucial for this process . Nuclear localization of Fe65, along with its interaction partner RNA-binding protein SART3, can trigger apoptosis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rnf152; E3 ubiquitin-protein ligase RNF152; RING finger protein 152; RING-type E3 ubiquitin transferase RNF152
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGITKL PPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERTLLPGDMGCR LLPGSQQKSLTVVTIPAEQQPLQGGAPPEAVEEEPDRRGVVKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG
Uniprot No.

Target Background

Function

RNF152 is an E3 ubiquitin-protein ligase that mediates Lys-63-linked polyubiquitination of RRAGA in response to amino acid starvation. This regulates mTORC1 signaling and influences cellular responses to amino acid availability. Additionally, RNF152 mediates Lys-48-linked polyubiquitination of target proteins, leading to proteasomal degradation. Overexpression of RNF152 induces apoptosis.

Database Links
Protein Families
RNF152 family
Subcellular Location
Lysosome membrane; Single-pass membrane protein.

Q&A

What is RNF152 and what are its structural characteristics?

RNF152 is an E3 ubiquitin ligase containing both a RING-finger domain and a transmembrane (TM) domain. The RING domain is essential for its ubiquitin ligase activity, while the transmembrane domain localizes the protein to lysosomal membranes. RNF152 can mediate autoubiquitination and is known to target specific substrates for ubiquitination, most notably the RagA GTPase . The protein functions within multiple signaling pathways, including mTORC1 regulation and inflammatory signaling cascades.

What are the primary cellular functions of RNF152?

RNF152 serves multiple crucial functions in cellular homeostasis and development:

  • Negative regulation of mTOR signaling through K63-linked polyubiquitination of RagA, which activates its inhibitor GATOR1, thereby inactivating mTORC1 signaling

  • Control of cell proliferation, particularly in neural progenitor cells during development

  • Positive regulation of TLR/IL-1R-mediated inflammatory responses by enhancing MyD88-dependent pathways

  • Essential roles in neurogenesis through regulation of NeuroD expression

These diverse functions position RNF152 at the intersection of cellular growth, development, and immune response pathways.

How is RNF152 expression regulated during development?

During embryonic development, RNF152 expression shows temporal and spatial specificity. In neural tube development, RNF152 is transcriptionally induced by the forkhead-type transcription factor FoxA2, particularly in the floor plate region . Studies in zebrafish have demonstrated developmental stage-specific expression patterns that can be detected through RT-PCR analysis and whole-mount in situ hybridization (WISH) techniques .

To investigate RNF152 expression patterns, researchers commonly use:

  • RT-PCR with stage-specific primers (forward: TCTCCCATCTCCCAGATG, reverse: AGACCGTCATGTCCTAGA for zebrafish rnf152)

  • Whole-mount in situ hybridization with DIG-labeled antisense probes

  • Immunohistochemistry in tissue sections with specific antibodies against RNF152

How does RNF152 regulate the mTOR signaling pathway?

RNF152 functions as a negative regulator of mTOR signaling through its E3 ubiquitin ligase activity. The mechanism involves:

  • RNF152-mediated ubiquitination of the GDP-bound form of RagA, targeting it for degradation

  • Reduction of active RagA levels, which is required for mTORC1 activation

  • Subsequent downregulation of mTOR signaling, as evidenced by decreased phosphorylation of downstream targets like p70S6K and S6

Experimental evidence shows that RNF152 overexpression reduces phosphorylated p70S6K levels, while RNF152 knockdown results in hyperactivation of mTOR signaling . These findings establish RNF152 as an important upstream regulator of this critical cellular growth pathway.

What experimental approaches can demonstrate RNF152's effect on mTOR signaling?

Researchers investigating RNF152's impact on mTOR signaling typically employ these methodological approaches:

  • Overexpression studies:

    • Transfection of RNF152 expression plasmids in cell culture

    • Electroporation of expression constructs in embryonic tissues

    • Injection of capped mRNA (approximately 200 pg) in early-stage embryos

  • Loss-of-function studies:

    • siRNA knockdown using target-specific siRNAs

    • CRISPR/Cas9-mediated gene deletion

    • Morpholino antisense oligonucleotides in developmental models

  • Readouts of mTOR activity:

    • Western blot analysis of phosphorylated mTOR targets (p-p70S6K, pS6)

    • Immunohistochemistry to visualize spatial patterns of mTOR activation

    • Cell proliferation assays (e.g., pHH3 immunostaining for mitotic cells)

Why are RNF152 knockout mice viable despite its role in mTOR regulation?

Despite RNF152's important role in mTOR signaling regulation, RNF152 knockout mice are viable, suggesting compensatory mechanisms exist . This stands in contrast to RagA knockout mice, which exhibit severe morphological and growth defects leading to embryonic lethality around E10.5 .

Several hypotheses may explain this paradox:

  • Functional redundancy with other E3 ubiquitin ligases that can similarly target RagA

  • Activation of alternative regulatory pathways that maintain mTOR signaling homeostasis

  • Tissue-specific or temporal requirements for RNF152 that allow for compensatory mechanisms during development

To properly investigate these compensatory mechanisms, researchers should consider conditional knockout approaches that delete RNF152 function in specific tissues or developmental stages, which may reveal more dramatic phenotypes than global knockouts .

How does RNF152 influence neural progenitor proliferation?

RNF152 plays a critical role in regulating neural progenitor proliferation, particularly in the floor plate region of the developing neural tube. The mechanism involves:

  • Expression of RNF152 in the floor plate, induced by the transcription factor FoxA2

  • Negative regulation of mTOR signaling in these cells through RagA ubiquitination

  • Maintenance of an appropriately low proliferation rate in floor plate cells despite high Sonic Hedgehog (Shh) exposure

Experimental evidence demonstrates that knockdown of RNF152 using siRNA leads to aberrant upregulation of mTOR signaling and inappropriate cell division in the floor plate, as evidenced by ectopic expression of the mitotic marker pHH3 in cells that would normally remain quiescent .

What is the relationship between RNF152 and neurogenesis?

RNF152 is essential for proper neurogenesis through several mechanisms:

  • Regulation of NeuroD expression, a key neurogenic transcription factor

  • Influence on Delta-Notch signaling pathways during neural development

  • Control of the balance between proliferation and differentiation in neural progenitors through modulation of mTOR activity

In zebrafish models, manipulation of RNF152 expression affects eye development and midbrain-hindbrain boundary (MHB) formation. Morpholino-mediated knockdown results in smaller eye diameter and reduced rhombomeres (r1-7) compared to wild-type and control embryos .

How can researchers quantify RNF152's effects on neural development?

Researchers studying RNF152's role in neural development can employ these quantitative approaches:

  • Morphological measurements:

    • Eye diameter measurements in developing embryos

    • Neural tube width measurements

    • Quantification of specific neural domains using marker gene expression

  • Cell proliferation analysis:

    • Counting pHH3-positive cells in specific neural domains

    • BrdU incorporation assays to measure S-phase entry

    • Cell cycle analysis using flow cytometry

  • Gene expression quantification:

    • qRT-PCR for neurogenic genes like NeuroD

    • RNA-seq to identify global transcriptional changes

    • In situ hybridization intensity analysis for spatial expression patterns

How does RNF152 regulate TLR/IL-1R signaling pathways?

RNF152 functions as a positive regulator of Toll-like receptor (TLR) and interleukin-1 receptor (IL-1R) signaling through an unexpected mechanism:

  • Enhancement of MyD88-dependent pathways, which are critical for inflammatory cytokine production

  • Facilitation of MyD88 oligomerization, promoting the assembly of the Myddosome signaling complex

  • Specific regulation of MyD88-dependent but not TRIF-dependent pathways

Interestingly, the E3 ubiquitin ligase activity of RNF152 is not required for this function, as E3-deficient mutants (RNF152-C30S and RNF152-ΔR) still potentiate IL-1β-stimulated NF-κB activation . This reveals a novel non-enzymatic function of RNF152 in immune signaling.

What experimental evidence supports RNF152's role in inflammatory responses?

Multiple lines of experimental evidence demonstrate RNF152's importance in inflammatory signaling:

  • In vitro studies:

    • Overexpression of RNF152 activates NF-κB reporter in a dose-dependent manner

    • RNF152 potentiates IL-1β-triggered NF-κB activation

    • siRNA-mediated knockdown of RNF152 inhibits IL-1β- and LPS-induced inflammatory responses

  • In vivo evidence:

    • RNF152-deficient mice produce significantly less inflammatory cytokines (IL-6, TNFα) in response to LPS challenge

    • RNF152-deficient mice show greater resistance to LPS-induced lethal endotoxemia

  • Pathway specificity:

    • RNF152 deficiency does not affect TRIF-dependent production of IFN-β

    • RNF152 does not impact RIG-I-VISA or cGAS-STING signaling pathways

How can researchers distinguish between RNF152's roles in mTOR signaling versus inflammatory pathways?

To differentiate between RNF152's dual functions, researchers can employ these experimental strategies:

  • Structure-function analysis:

    • Use E3 ligase-deficient mutants (RNF152-C30S, RNF152-ΔR) that retain inflammatory pathway activation but lose mTOR regulatory capacity

    • Create domain-specific mutants to identify regions responsible for each function

  • Pathway-specific readouts:

    PathwayReadouts to MeasureRNF152 Effect
    mTOR signalingp-p70S6K, pS6 levelsNegative regulator
    TLR/IL-1R signalingNF-κB activation, IL-6/TNFα productionPositive regulator
    TRIF-dependent signalingIFN-β productionNo significant effect
  • Genetic rescue experiments:

    • Introduce pathway-specific downstream components to rescue phenotypes in RNF152-deficient models

    • Use rapamycin (mTOR inhibitor) to determine if phenotypes are mTOR-dependent

What are effective gene manipulation approaches for RNF152 functional studies?

Researchers have employed various strategies to manipulate RNF152 expression and function:

  • Overexpression methods:

    • Cloning the complete RNF152 ORF (675bp in zebrafish) into expression vectors

    • For zebrafish studies, injection of capped mRNA (200 pg) at the 1-2 cell stage

    • For neural tube studies, electroporation of expression plasmids into specific regions

  • Knockdown/knockout approaches:

    • siRNA-mediated knockdown (verified by testing multiple siRNAs with different efficiencies)

    • Morpholino antisense oligonucleotides for developmental studies

    • CRISPR/Cas9-mediated gene editing for stable genetic models

  • Mutagenesis strategies:

    • Point mutations in the RING domain (e.g., C30S) to eliminate E3 ligase activity

    • Domain deletion constructs (e.g., RNF152-ΔR lacking the RING domain)

What readout assays best measure RNF152 activity in different contexts?

The choice of assay depends on which RNF152 function is being investigated:

  • For ubiquitination activity:

    • Autoubiquitination assays to test E3 ligase function

    • Co-immunoprecipitation followed by ubiquitin immunoblotting to detect RagA ubiquitination

    • K63-specific ubiquitin antibodies to distinguish linkage types

  • For mTOR pathway regulation:

    • Western blot analysis of phosphorylated mTOR targets (p-p70S6K, pS6)

    • Immunohistochemistry for spatial patterns of mTOR activation

    • Cell proliferation assays using pHH3 immunostaining

  • For inflammatory pathway activation:

    • NF-κB reporter assays in cell culture

    • qRT-PCR for inflammatory cytokine transcription

    • ELISA to measure cytokine production in cell supernatants or serum

How can researchers analyze RNF152 expression patterns during development?

Multiple complementary techniques can reveal RNF152 expression dynamics:

  • Transcriptional analysis:

    • RT-PCR or qRT-PCR with stage-specific primers

    • RNA-seq for genome-wide expression analysis

    • Whole-mount in situ hybridization (WISH) for spatial localization

  • Protein detection:

    • Western blotting of tissue lysates at different developmental stages

    • Immunohistochemistry on tissue sections

    • Fluorescent reporter constructs (e.g., RNF152-GFP fusion proteins)

  • Promoter analysis:

    • Identification of transcription factor binding sites (e.g., FoxA2 binding sites)

    • Reporter assays with RNF152 promoter constructs

    • ChIP assays to verify transcription factor binding

How do RNF152's roles in mTOR and immune signaling integrate at the cellular level?

This represents a challenging research question that brings together RNF152's dual functions. Potential experimental approaches include:

  • Single-cell analysis to determine if RNF152 exerts both functions simultaneously or in different cellular contexts

  • Identification of common interaction partners between pathways

  • Investigation of subcellular localization patterns under different stimulation conditions

  • Systems biology approaches to model pathway cross-regulation

The integration may be particularly relevant in immune cells where both pathways are active, such as during T cell activation where mTOR signaling drives metabolic changes while TLR/IL-1R pathways regulate inflammatory responses.

What are the molecular mechanisms behind RNF152's E3-independent functions?

The finding that RNF152 can regulate TLR/IL-1R signaling independently of its E3 ubiquitin ligase activity raises important questions about alternate molecular mechanisms:

  • Potential scaffolding functions that facilitate protein complex assembly

  • Possible sequestration of negative regulators through direct binding

  • Allosteric regulation of interacting proteins

To investigate these mechanisms, researchers should consider:

  • Proteomic approaches to identify all RNF152 interaction partners

  • Structural studies to reveal binding interfaces

  • Domain mapping to identify regions essential for E3-independent functions

What compensatory mechanisms explain the viability of RNF152 knockout mice?

Despite RNF152's important roles, knockout mice are viable , suggesting compensatory mechanisms:

  • Identification of other E3 ligases with overlapping substrate specificity

  • Temporal transcriptome and proteome analysis of knockout animals to detect compensatory changes

  • Double knockout studies combining RNF152 deletion with related regulatory proteins

Understanding these compensatory mechanisms could reveal new therapeutic targets and provide insights into the robustness of developmental and signaling networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.