Recombinant Mouse E3 ubiquitin-protein ligase RNF182 (Rnf182)

Shipped with Ice Packs
In Stock

Description

General Information

Rnf182 is a low-abundance cytoplasmic protein with preferential expression in the brain . The human RNF182 protein exhibits high sequence homology to rodent RNF182, with 98% and 97% sequence identity to mouse and rat, respectively . The protein contains a RING finger domain, which is crucial for its E3 ubiquitin ligase activity, and leucine repeats potentially involved in protein-protein interactions .

Structure

The predicted primary structure of RNF182 includes:

  • A C3HC4-type RING finger domain between amino acids C20 and C67 .

  • Two putative transmembrane helices located at the C-terminus, spanning amino acids 178 to 200 and 212 to 234, respectively .

  • Four leucine repeats between amino acids 197 and 225, located within the two transmembrane domains .

Expression Patterns

RNF182 is weakly expressed and not easily detectable by Northern blotting . Quantitative RT-PCR analysis has shown that RNF182 gene expression increases during retinoic acid (RA)-induced differentiation of human NT2 cells, with elevated transcript levels in both NT2 neurons and NT2 astrocytes . Tissue distribution analysis using RT-PCR revealed RNF182 expression in the mouse cortex, hippocampus, cerebellum, and spinal cord, but not in heart, liver, kidney, or skeletal muscle, indicating it is a brain-enriched gene .

Function and E3 Ubiquitin Ligase Activity

RNF182 functions as an E3 ubiquitin ligase, stimulating E2-dependent polyubiquitination in vitro . It mediates the ubiquitination of ATP6V0C, targeting it for degradation via the ubiquitin-proteasome pathway . RNF182 also plays a role in inhibiting TLR-triggered innate immune response by mediating 'Lys'-48-linked ubiquitination and subsequent degradation of the NF-kappa-B component RELA .

Interaction with ATP6V0C

RNF182 interacts with ATP6V0C, a component of the V-ATPase responsible for acidifying intracellular compartments . This interaction leads to the degradation of ATP6V0C via the ubiquitin-proteasome pathway .

Role in Alzheimer's Disease (AD)

RNF182 expression is elevated in post-mortem AD brain tissue, and the gene can be up-regulated in vitro in cultured neurons subjected to cell death-inducing injuries . Overexpression of RNF182 reduces cell viability, suggesting it can disrupt cellular homeostasis .

Role in Lung Adenocarcinoma (LUAD)

RNF182 expression is significantly decreased in LUAD tissues compared to normal tissues . Low expression of RNF182 is associated with poor survival in LUAD and lung cancer patients . RNF182 expression is inhibited by Bap, promoting lung cancer tumorigenesis through activating AhR and promoting abnormal methylation .

The correlation of RNF182 expression with clinical features in LUAD patients is shown in the table below :

Clinic featuresSample size (n = 47)RNF182 expressionp Value
High (n = 22)Low (n = 25)
Age
≥60291613
<6018612
Sex
Male311714
Female16511
T stage
T114113
T2–T4331122
N stage
N0301812
N1–N217413
M stage
M0412219
M1606
Clinical stage

RNF182 and Methylation

Methylation analysis indicates that RNF182 expression is influenced by DNA methylation in NSCLC samples . An inverse correlation exists between RNF182 expression levels and methylation intensity in LUAD and LUSC samples . Bisulfite genomic sequencing (BGS) analysis reveals extensive methylation in tumor tissues compared to adjacent normal tissues .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rnf182; E3 ubiquitin-protein ligase RNF182; RING finger protein 182; RING-type E3 ubiquitin transferase RNF182
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Rnf182
Target Protein Sequence
MASQPLEEPAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQG VIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVS PSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQT SIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHEFL DCMALPS
Uniprot No.

Target Background

Function

RNF182 is an E3 ubiquitin-protein ligase that ubiquitinates ATP6V0C, targeting it for degradation via the ubiquitin-proteasome pathway. It also plays a role in inhibiting TLR-triggered innate immune responses by mediating Lys48-linked ubiquitination and subsequent degradation of the NF-κB component RELA.

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm.
Tissue Specificity
Expressed in the cortex, hippocampus, cerebellum and spinal cord, but not in the heart, liver, kidney or skeletal muscle.

Q&A

What is the basic structure of RNF182 and what functional domains does it contain?

RNF182 contains a typical C3HC4-type RING finger domain located between amino acids C20 and C67, which is essential for its E3 ubiquitin ligase activity. The protein also features two putative transmembrane helices at the C-terminus (spanning amino acids 178-200 and 212-234) and four leucine repeats between amino acids 197 and 225. The primary structure is highly conserved across species, with human RNF182 showing 98% and 97% sequence identity to mouse and rat homologs, respectively .

What is the tissue distribution and expression pattern of RNF182?

RNF182 is primarily a brain-enriched protein with low abundance in normal conditions. Through semi-quantitative RT-PCR analysis, RNF182 expression has been detected in mouse cortex, hippocampus, cerebellum, and spinal cord, but not in heart, liver, kidney, or skeletal muscle . The protein is weakly expressed under normal conditions but can be significantly upregulated in response to cellular stress or during differentiation processes.

What is the subcellular localization of RNF182?

RNF182 primarily localizes in the cytoplasm, with a punctuated pattern observed particularly in cytoplasmic and perinuclear regions. Co-localization studies with binding partners such as ATP6V0C have confirmed this cytoplasmic distribution pattern . This localization is consistent with its role in protein degradation via the ubiquitin-proteasome pathway.

What cellular models are most suitable for studying RNF182 function?

Several cellular models have proven effective for RNF182 research:

Model SystemApplicationsAdvantages
Neuronal cell lines (N2a)Overexpression/knockdown studies, cell death mechanismsRelevant for neurodegeneration research
NT2 neuronsDifferentiation studies, response to injurious stimuliModels neuronal differentiation and injury response
MacrophagesImmune response, TLR signalingAppropriate for studying inflammatory regulation
HEK293 knockout cell linesLoss-of-function studiesGenetically defined system for mechanistic studies

The choice of model depends on the specific research questions. For neurodegeneration studies, neuronal models are preferred, while macrophages are more suitable for investigating immune regulation functions .

What are the established methods to assess RNF182 E3 ligase activity?

In vitro ubiquitination assays represent the gold standard for assessing RNF182 E3 ligase activity. This typically involves:

  • Expression and purification of recombinant RNF182 (His-tagged or GST-tagged)

  • Setting up reaction mixtures containing:

    • Purified E1 enzyme

    • Appropriate E2 conjugating enzyme

    • Ubiquitin

    • ATP regeneration system

    • RNF182 protein

  • Incubation and detection of ubiquitination by Western blotting

RNF182 has been demonstrated to function as a substrate-independent, E2-dependent E3 ubiquitin ligase. Control reactions omitting E1, E2, E3, or ubiquitin are essential to validate results . For substrate-specific ubiquitination studies, purified potential substrates (such as ATP6V0C or p65) should be included in the reaction mixture.

How can RNF182 expression be efficiently modulated for functional studies?

Several approaches have been validated for modulating RNF182 expression:

ApproachMethodologyApplicationsConsiderations
OverexpressionTransfection with mammalian expression vectors (e.g., pEGFP-N1 with RNF182 insert)Gain-of-function studiesMay cause non-physiological effects due to excessive expression
siRNA knockdownTransfection with siRNA mixtures targeting RNF182Loss-of-function studiesTransient effect, requires validation of knockdown efficiency
CRISPR/Cas9 knockoutGeneration of stable knockout cell linesLong-term functional studiesAvailable commercial lines (e.g., HEK293 RNF182 KO) or custom generation
Inducible systemsTet-on/off systems for controlled expressionTemporal regulation studiesRequires optimization of induction parameters

For neuronal models, plasmid transfection efficiency should be optimized, as these cells can be challenging to transfect. The timing of expression modulation is critical, particularly when studying stress responses or cell death mechanisms .

What are the validated protein interactions of RNF182, and how should researchers investigate new potential interactions?

RNF182 has been confirmed to interact with:

  • ATP6V0C - a component involved in gap junction complexes and neurotransmitter release channels

  • p65 (RelA) - a key component of the NF-κB signaling pathway

To investigate new potential interactions, researchers should employ a multi-method approach:

  • Initial screening via yeast two-hybrid assays

  • Validation through co-immunoprecipitation in relevant cell types

  • Confirmation of subcellular co-localization using immunofluorescence microscopy

  • Functional validation through domain mapping and mutagenesis studies

The interaction with ATP6V0C does not require the RING finger domain, suggesting that different domains of RNF182 may mediate distinct protein interactions .

How does RNF182 regulate protein degradation, and what are its confirmed substrates?

RNF182 facilitates protein degradation through the ubiquitin-proteasome pathway by promoting K48-linked polyubiquitination of target proteins. Confirmed substrates include:

SubstrateFunctionConsequence of RNF182-mediated degradation
ATP6V0CGap junction complexes, neurotransmitter releaseImpaired neuronal communication, possible contribution to neurodegeneration
p65 (RelA)NF-κB signaling, inflammatory responseSuppression of proinflammatory cytokine production

The degradation process involves:

  • Physical interaction between RNF182 and substrate

  • E2-dependent K48-linked polyubiquitination catalyzed by RNF182

  • Recognition and degradation of ubiquitinated substrates by the 26S proteasome

This activity can be validated using proteasome inhibitors (e.g., MG132) to demonstrate accumulation of ubiquitinated substrates .

What signaling pathways are known to regulate RNF182 expression?

RNF182 expression is regulated by various stress and differentiation signals:

  • Neuronal differentiation: Upregulated during retinoic acid-induced differentiation of human NT2 cells

  • Cellular stress responses:

    • Significantly increased in neuronal cells subjected to oxygen and glucose deprivation (OGD)

    • Further elevated when β-amyloid peptide is added during OGD treatment

  • TLR signaling: Specifically upregulated by TLR stimuli (TLR4, TLR3, and TLR9 agonists) in macrophages

This regulation appears to be transcriptional, as changes in mRNA levels precede protein accumulation. The specific transcription factors mediating these responses require further investigation .

What is the evidence for RNF182 involvement in Alzheimer's disease pathogenesis?

Multiple lines of evidence support RNF182 involvement in Alzheimer's disease (AD):

  • Expression studies:

    • Consistently higher RNF182 transcript levels in AD brain samples compared to age-matched controls

    • Validated in both pooled RNA and individual brain samples from tissue banks

  • Cellular response patterns:

    • Upregulation in neuronal cells subjected to AD-relevant stressors, including oxygen-glucose deprivation and β-amyloid peptide exposure

    • The combination of these stressors produced synergistic upregulation of RNF182

  • Functional consequences:

    • Overexpression of RNF182 alone triggered cell death in neuronal models

    • RNF182-mediated degradation of ATP6V0C may disrupt gap junction complexes and neurotransmitter release

These findings suggest RNF182 may participate in neurodegeneration cascades, potentially through disruption of neuronal communication and/or direct promotion of cell death pathways .

How does RNF182 contribute to neuronal cell death, and what approaches can be used to study this function?

RNF182 appears to promote neuronal cell death through multiple mechanisms:

  • Direct effect: Overexpression of RNF182 alone is sufficient to reduce neuronal cell viability

  • Substrate regulation: Degradation of ATP6V0C may impair neuronal function and resilience

  • Stress amplification: RNF182 expression increases in response to cellular stress, potentially creating a positive feedback loop

To study these mechanisms effectively, researchers should:

ApproachMethodologyOutcome Measures
Gain/loss of functionOverexpression or knockdown of RNF182Cell viability (MTT, LDH release), apoptosis markers (caspase activation, TUNEL)
Stress responseOGD, β-amyloid exposure with RNF182 modulationComparative cell survival rates, stress pathway activation
Substrate rescueCo-expression of ATP6V0C with RNF182Assessment of whether substrate overexpression mitigates RNF182 effects
Domain mutantsExpression of RNF182 with inactive RING domainDetermination of E3 ligase dependence of phenotypes

Importantly, downregulation of endogenous RNF182 significantly reduced cell death caused by OGD treatment, suggesting potential neuroprotective strategies .

How does RNF182 regulate TLR signaling and inflammatory responses?

RNF182 functions as a feedback-negative regulator of TLR signaling through the following mechanism:

  • TLR stimulation (via TLR4, TLR3, or TLR9 agonists) upregulates RNF182 expression in macrophages

  • RNF182 physically interacts with p65 (RelA), a key component of NF-κB signaling

  • This interaction facilitates K48-linked polyubiquitination of p65

  • Ubiquitinated p65 undergoes proteasomal degradation

  • Reduced p65 levels inhibit TLR-triggered proinflammatory cytokine production

This mechanism provides a feedback loop to limit excessive inflammation following TLR activation. Importantly, RNF182 selectively affects proinflammatory cytokine production without influencing type I interferon responses, distinguishing it from other RNF family proteins .

What experimental approaches are most suitable for studying RNF182's role in inflammation?

To comprehensively study RNF182's role in inflammation:

ApproachMethodsApplications
Expression analysisqRT-PCR, Western blottingDetermine RNF182 regulation by inflammatory stimuli
TLR signaling assessmentELISA for cytokines, qRT-PCR, reporter assaysMeasure impact on inflammatory mediators
Protein interaction studiesCo-IP, immunofluorescence co-localizationConfirm and map interactions with signaling components
Ubiquitination assaysIP followed by ubiquitin-specific Western blottingDetermine ubiquitination patterns (K48 vs. K63)
In vivo inflammation modelsRNF182 knockout mice, inflammatory disease modelsPhysiological relevance of regulatory mechanisms

When designing these experiments, researchers should consider the temporal dynamics of inflammation, as RNF182's role appears to be in the resolution/limitation phase rather than the initiation phase .

How does RNF182 selectively regulate proinflammatory cytokines without affecting type I interferons?

This selective regulation represents an intriguing aspect of RNF182 function:

  • Knockdown of RNF182 amplifies production of proinflammatory cytokines (e.g., TNF, IL-6) but not type I interferons following TLR stimulation

  • This selectivity occurs despite both pathways being downstream of TLR activation

  • The mechanism appears to involve specific targeting of the NF-κB pathway (through p65 degradation) while sparing IRF3/7-dependent pathways

This dichotomy suggests RNF182 fine-tunes rather than broadly suppresses innate immune responses. Researchers investigating this selectivity should:

  • Compare effects on canonical vs. non-canonical NF-κB pathways

  • Assess impacts on specific transcription factor complexes at proinflammatory gene promoters

  • Examine potential compartmentalization of RNF182 activity in cellular subdomains

What is the potential therapeutic relevance of modulating RNF182 in neurological and inflammatory conditions?

The dual role of RNF182 in neurodegeneration and inflammation presents interesting therapeutic possibilities:

ConditionPotential ApproachMechanistic RationaleResearch Needs
Alzheimer's diseaseRNF182 inhibitionReduce ATP6V0C degradation, limit neuronal deathValidation in animal models, development of specific inhibitors
Inflammatory disordersRNF182 activation/mimeticsEnhance p65 degradation, limit excessive inflammationPathway specificity, temporal control of intervention
Ischemic brain injuryContext-dependent approachBalance between anti-inflammatory benefits and potential neuronal toxicityDetermination of dominant pathway in specific conditions

The development of small molecule modulators of RNF182 activity or substrate recognition would represent an important advance. Additionally, tissue-specific targeting strategies would help address the potentially opposing effects in different cell types .

How might researchers resolve the apparent paradox of RNF182 being protective in inflammation but detrimental in neurodegeneration?

This paradox represents a complex research challenge:

  • Cell-type specificity: RNF182 may target different substrates in neurons vs. immune cells

  • Context-dependent functions: The same molecular mechanism may have different outcomes depending on cellular context

  • Temporal dynamics: Acute vs. chronic upregulation may lead to distinct consequences

  • Substrate availability: The relative abundance of ATP6V0C vs. p65 may differ between cell types

To address this paradox, investigators should:

  • Perform comprehensive substrate identification in different cell types using proteomics approaches

  • Develop cell-type specific knockout models to separate neuronal from immunological functions

  • Examine temporal dynamics of RNF182 function using inducible systems

  • Investigate potential regulators of RNF182 substrate specificity

What technical challenges remain in studying RNF182, and how might they be overcome?

Several technical challenges complicate RNF182 research:

ChallengeImpactPotential Solutions
Low endogenous expressionDifficulty detecting native proteinDevelop higher sensitivity antibodies, use epitope tagging strategies
Multiple protein interactionsComplex functional networkEmploy systematic interactome analysis, develop domain-specific mutants
Context-dependent functionsInconsistent results across modelsStandardize experimental conditions, use relevant primary cell models
Transient regulationTiming-dependent effectsEmploy time-course studies, develop real-time monitoring tools
Post-translational modificationsUnknown regulation of RNF182 itselfCharacterize RNF182 modifications and their functional consequences

Future technological advances including CRISPR-based endogenous tagging, improved mass spectrometry for ubiquitination site mapping, and development of specific small molecule inhibitors would significantly advance the field .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.