Recombinant Mouse E3 ubiquitin-protein ligase RNF19B (Rnf19b)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse E3 Ubiquitin-Protein Ligase RNF19B (Rnf19b)

Recombinant Mouse E3 ubiquitin-protein ligase RNF19B, also known as Rnf19b, is a protein that functions as an E3 ubiquitin ligase . E3 ubiquitin ligases are enzymes that play a critical role in the ubiquitination process, which involves attaching ubiquitin to target proteins, thereby marking them for degradation or altering their function . RNF19B is essential in various biological processes, particularly in the immune system and cellular responses to infections .

Gene Structure and Protein Domains

The RNF19B gene in mice is located on chromosome 4 and consists of multiple exons . The protein encoded by this gene is a multi-pass membrane protein, characterized by specific structural motifs :

  • RING-type zinc finger motifs RNF19B contains two RING-type zinc finger motifs, which are crucial for its E3 ubiquitin ligase activity . The RING domain facilitates the binding of E2 ubiquitin-conjugating enzymes and mediates the transfer of ubiquitin to target proteins .

  • IBR-type zinc finger motif In addition to the RING domains, RNF19B also possesses one IBR-type zinc finger motif . The precise function of the IBR domain remains not fully understood, but it is thought to be involved in protein-protein interactions and regulation of E3 ligase activity .

  • Transmembrane domains Computer analysis has predicted that RNF19B is a transmembrane protein. It contains two transmembrane domains . These domains facilitate its localization and function within the cell membrane.

  • Intrinsically disordered regions (IDR) RNF19B contains two intrinsically disordered regions, IDR1 and IDR2 . These regions might be involved in protein-protein interactions and regulatory functions.

Function as an E3 Ubiquitin Ligase

RNF19B functions as an E3 ubiquitin ligase, which is essential for its role in the ubiquitination pathway . The ubiquitination process involves several steps:

  1. Activation An E1 ubiquitin-activating enzyme activates ubiquitin (Ub) .

  2. Conjugation The activated Ub is transferred to an E2 ubiquitin-conjugating enzyme .

  3. Ligation The E3 ubiquitin ligase, in this case RNF19B, recognizes the target protein and facilitates the transfer of Ub from the E2 enzyme to the target protein .

This process can result in:

  • Protein degradation Polyubiquitination, where multiple ubiquitin molecules are attached, often marks the protein for degradation by the proteasome .

  • Altered protein function Monoubiquitination, where a single ubiquitin molecule is attached, can alter the protein's function, localization, or interaction with other proteins .

Role in the Immune System

RNF19B, also referred to as Natural Killer Lytic-Associated Molecule (NKLAM), plays a significant role in the innate immune system . Key findings include:

  • Regulation of cytokine production RNF19B influences the production of pro-inflammatory cytokines and chemokines. Studies have shown that macrophages from RNF19B knockout mice produce less IFNβ, IL-6, IFNγ, and MCP-1 when stimulated with LPS or poly (I:C) .

  • Modulation of transcription factors RNF19B is involved in regulating the phosphorylation state of transcription factors such as STAT1 and NFκB. It positively modulates their transcriptional activity, possibly by promoting the degradation of key phosphatases .

  • Innate immune response to infections RNF19B expression is upregulated in response to various infections, including viral and bacterial pathogens. It is considered an important component of innate immunity .

Involvement in Disease

Research indicates that RNF19B is implicated in several diseases and conditions:

  • Infectious diseases Studies have shown altered RNF19B expression in response to infections, suggesting its role in the immune response against pathogens .

  • Osteoporosis One study identified NKLAM as a candidate gene associated with osteoclast differentiation, indicating a potential role in osteoporosis .

  • Acute myocardial infarction RNF19B gene expression was found to be upregulated in patients with acute myocardial infarction, suggesting its involvement in inflammatory processes related to heart disease .

Regulation of Inflammatory Signaling Pathways

RNF19B affects several inflammatory signaling pathways. For example, the NFκB pathway, crucial for the immune response, is modulated by RNF19B . Specifically:

  • NFκB activation Nuclear translocation of the NFκB protein p65 is delayed in RNF19B knockout macrophages compared to wild-type macrophages after LPS stimulation .

  • p65 phosphorylation Phosphorylation of p65 at serine 536 is attenuated in RNF19B knockout macrophages .

  • NFκB transcriptional activity RNF19B knockout macrophages exhibit reduced NFκB transcriptional activity and lower expression of iNOS, a protein regulated by NFκB .

RNF Family Proteins

RNF19B is a member of the RING finger protein family, which includes a large number of E3 ubiquitin ligases . These proteins are characterized by the presence of a RING domain and are involved in various cellular processes, including:

  • Regulation of transcription

  • RNA metabolism

  • Translation

  • Cellular signaling

  • Immunity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
Rnf19b; Ibrdc3; Nklam; E3 ubiquitin-protein ligase RNF19B; IBR domain-containing protein 3; Natural killer lytic-associated molecule; RING finger protein 19B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-732
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Rnf19b
Target Protein Sequence
MGSEKDSESPRSTSLHAAAPDPKCRSGGRRRRLTFHSVFSASARGRRARTKPQAEPPPPA APPPPPPPAPAPVEAQAPPVEALPSEPAAEAEAEAVAAGPEEDEAAEGGGAEEVECPLCL VRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRVPISCPECSERLNPHDIRLLLADPP LMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASCPKLTCEREGCQTEFCYHCKQ IWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPADDIKPCPRCSAYIIKMNDGSCN HMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQLGTLIGAPVGISL IAGIAIPAMVIGIPVYVGRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVSVGI GVPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWRALKNPSIGE SSIEGLTSVLSTSGSPTDGLSVMQGPYSETASFAALSGGTLSGGILSSGKGKYSRLEVQA DVQKEIFPKDTASLGAISDSASTRAMAGSIISSYNPQDRECNNMEIQVDIEAKPSHYQLV SGSSTEDSLHVHAQVAEKEEEGNGAGGGSGGSEDDPPYKHQSCEQKDCLASKAWDISLAQ PESIRSDLESSDTQSDDVPDITSDECGSPRSHAAACPSTPQVHGAPSPSAHKNLAAPAEG QTVLKSEEYEVE
Uniprot No.

Target Background

Function

RNF19B (also known as NKLAM) is an E3 ubiquitin-protein ligase. It receives ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 via a thioester intermediate, subsequently transferring it to target substrates such as UCKL1. RNF19B plays a crucial role in the cytotoxic activity of natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), and exhibits a protective effect against staurosporin-induced apoptosis.

Gene References Into Functions
  1. E3 ubiquitin ligase NKLAM positively regulates macrophage inducible nitric oxide synthase expression. PMID: 25182373
  2. NKLAM is a component of macrophage phagosomes and contributes to macrophage bactericidal activity. PMID: 23085241
  3. Studies support NKLAM's role in NK cell function in vitro and in vivo. PMID: 19915045
Database Links
Protein Families
RBR family, RNF19 subfamily
Subcellular Location
Cytoplasmic granule membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed specifically in natural killer cells, activated macrophages and cytotoxic T-cells. Present in macrophages (at protein level). Ubiquitously expressed with high expression in testis.

Q&A

What is RNF19B and what is its primary function?

RNF19B is a member of a small family of E3 ubiquitin ligases with a characteristic cysteine-rich RING-IBR-RING (RBR) domain that mediates the ubiquitination of multiple substrates . It was initially discovered in 1999 and has since been recognized for its integral function in innate immune responses, particularly in natural killer (NK) cells and macrophages. RNF19B catalyzes the transfer of ubiquitin to target proteins, which can lead to proteasome-mediated degradation or altered protein localization and function . One of its key functions is mediating K48-linked polyubiquitination of target proteins such as RAC1, leading to their degradation via the ubiquitin-proteasome pathway .

What is the structural composition of RNF19B?

RNF19B contains several functional domains essential for its activity:

  • A characteristic RBR (RING1-IBR-RING2) core domain containing a catalytic cysteine (C316 in human RNF19B)

  • At least two transmembrane domains

  • An N-terminal extension

  • A C-terminal regulatory domain

The RBR core and at least one of the transmembrane domains are essential for its ubiquitin ligase activity . Unlike conventional RING E3 ligases, RBR E3 ligases like RNF19B require transfer of ubiquitin from the E2 ligase to a catalytic cysteine in their RING2 domain prior to transfer to a substrate .

How is RNF19B expression regulated in cells?

RNF19B expression is tightly regulated and can be induced by various stimuli:

Inducing FactorCell TypeTime to Peak ExpressionReference
IFNγMacrophages12 hours
IFNβNK cellsRapid induction
IL-2, IL-12, IL-15, IL-21NK cellsVariable
LPS + IFNγRAW 264.7, J774 cells16 hours
Poly (I:C) (TLR3 agonist)Bone marrow-derived macrophagesNot specified
Bacterial stimuli (E. coli, S. aureus)Macrophage cell lines16 hours

Under baseline conditions, both NK cells and macrophages express minimal amounts of RNF19B, but its expression is rapidly upregulated following stimulation . The RNF19B promoter contains binding sites for multiple transcription factors including IRF-1, IRF-2, and NFκB proteins p50 and p65/RelA, suggesting complex transcriptional regulation .

Which cell types express RNF19B?

RNF19B is expressed by various cell types, predominantly in the immune system:

  • Natural killer (NK) cells

  • CD8+ cytotoxic T cells

  • Bone marrow-derived macrophages (BMDM)

  • Peripheral blood monocytes

  • Splenic and peritoneal macrophages

  • Limited expression in non-immune cells:

    • Testicular cells (associated with ppp1cc)

    • Mouse tracheal epithelial cells (when treated with IFNγ)

What are the known substrates of RNF19B and their biological significance?

RNF19B has several identified substrates, with RAC1 being particularly well-characterized:

SubstrateUbiquitination TypeBiological EffectDisease Relevance
RAC1K48-linked polyubiquitinationDegradation via proteasome; Inhibition of cell migrationNSCLC progression
Small molecules (e.g., BRD1732)MonoubiquitinationAltered cellular response to small moleculesPotential therapeutic applications

RAC1 is a key substrate of RNF19B. The enzyme catalyzes K48-linked polyubiquitination of RAC1, leading to its proteasomal degradation . This is particularly significant as RAC1 is best known for its role in regulating cytoskeletal dynamics and cell migration. By downregulating RAC1, RNF19B can inhibit cancer cell migration and potentially metastasis. In non-small-cell lung cancer (NSCLC), the DIRAS3-RNF19B-RAC1 axis is associated with malignant progression, with DIRAS3 promoting the binding of RAC1 to RNF19B and enhancing RAC1 degradation .

How does RNF19B contribute to immune function?

RNF19B (NKLAM) plays critical roles in multiple immune cell types:

  • In NK cells:

    • Required for maximal cytotoxic activity

    • Localizes to lytic granule membranes

    • Contributes to cytokine production

  • In macrophages:

    • Enhances phagocytic killing capacity

    • Mediates cytokine production following pathogen stimulation

These functions position RNF19B as an important modulator of both innate immune surveillance and response to pathogens . The interferon-inducible nature of RNF19B suggests it participates in amplifying immune responses during infection or inflammation.

What is the evidence linking RNF19B to cancer progression?

RNF19B expression is significantly altered in several cancer types:

  • In NSCLC, RNF19B protein levels are lower compared to normal tissues

  • RNF19B has been identified as a novel biomarker affecting prognosis in neuroblastoma patients

  • The DIRAS3-RNF19B-RAC1 axis is associated with NSCLC malignant progression

Chi-squared tests performed on tissue microarrays containing 186 normal and NSCLC patient samples demonstrated an inverse correlation between DIRAS3 and RAC1 levels, with RNF19B acting as an intermediary in this pathway . Patients with high DIRAS3 and RNF19B levels often displayed low RAC1 expression and vice versa. This pattern suggests that reduced RNF19B expression in cancer may contribute to increased RAC1 levels, promoting cell migration and potentially metastasis.

How does the RNF19B mechanistic pathway differ from other E3 ubiquitin ligases?

RNF19B belongs to the RBR family of E3 ubiquitin ligases, which operate through a unique hybrid mechanism:

  • Unlike conventional RING E3 ligases that directly transfer ubiquitin from E2 to substrate

  • RBR ligases like RNF19B first accept ubiquitin from E2 (specifically UBE2L3) onto their catalytic cysteine

  • This forms a thioester intermediate before transferring ubiquitin to the substrate

  • This mechanism resembles both RING and HECT-type E3 ligases

This hybrid mechanism provides additional regulatory control and specificity in substrate ubiquitination. The requirement for UBE2L3 as an E2 partner is also distinctive of RNF19B function .

What are the optimal methods for studying RNF19B-mediated ubiquitination?

When investigating RNF19B-mediated ubiquitination, researchers should consider:

  • Ubiquitination assays:

    • In vivo ubiquitination can be assessed by co-immunoprecipitation followed by western blotting with anti-ubiquitin antibodies

    • Use of ubiquitin-specific antibodies (K48-linkage specific) for determining ubiquitin chain types

    • Proteasome inhibitors (MG132) can be included to prevent degradation of ubiquitinated proteins

  • Expression systems:

    • Both overexpression and knockdown/knockout approaches should be employed

    • CRISPR-Cas9 knockout of RNF19B followed by re-expression of wild-type or mutant forms is effective

    • Key controls include catalytically inactive RNF19B (C316A mutation) and domain deletion constructs

  • Protein stability assessment:

    • Cycloheximide chase assays (10 μg/mL) to inhibit new protein translation and examine target protein turnover

    • Compare protein stability in the presence and absence of RNF19B

What cellular models are most appropriate for studying RNF19B function?

Based on the available literature, the following cellular models have proven effective for studying different aspects of RNF19B biology:

Research FocusRecommended Cell ModelsKey Considerations
Immune functionNK cell lines, BMDM, RAW 264.7, J774IFN stimulation required for optimal expression
Cancer biologyNSCLC lines (H1792, Calu-1, A549), HEK293TConsider endogenous RNF19B expression levels
Ubiquitination mechanismsHEK293T with CRISPR RNF19A/B DKOGood system for reconstitution experiments

For immune function studies, primary NK cells and macrophages from mice or humans represent physiologically relevant models, though they require stimulation with interferons or cytokines to induce optimal RNF19B expression . For biochemical studies of RNF19B-mediated ubiquitination, HEK293T cells with CRISPR-mediated knockout of both RNF19A and RNF19B provide a clean background for reconstitution experiments .

What are the challenges in developing recombinant RNF19B for in vitro studies?

Several challenges exist when working with recombinant RNF19B:

  • Membrane association: RNF19B contains transmembrane domains that complicate protein purification and in vitro reconstitution

  • Catalytic mechanism: As an RBR E3 ligase, RNF19B requires a properly folded RING1-IBR-RING2 domain with an accessible catalytic cysteine

  • Complex formation: Some RNF19B functions may require additional cellular cofactors

  • In vitro reconstitution: Despite multiple attempts, researchers have been unable to reconstitute ubiquitination of certain substrates (e.g., BRD1732) by RNF19B with recombinant proteins

To overcome these challenges, consider:

  • Expression of truncated forms lacking transmembrane domains

  • Co-expression with relevant binding partners

  • Use of detergent-based extraction methods suitable for membrane proteins

  • Inclusion of relevant E1 and E2 (UBE2L3) enzymes in reconstitution attempts

What are emerging areas of RNF19B research?

Several exciting research directions are emerging for RNF19B:

  • Small molecule ubiquitination: The discovery that RNF19B can mediate ubiquitination of non-proteinaceous substrates (small molecules) opens new possibilities for directed ubiquitination strategies

  • Cancer biomarker development: The correlation between RNF19B expression and cancer prognosis suggests potential as a diagnostic or prognostic biomarker

  • Immune modulation: Further exploration of RNF19B's role in innate immunity could reveal new therapeutic targets for inflammatory diseases

  • Substrate identification: Comprehensive proteomics approaches to identify the full range of RNF19B substrates beyond RAC1

How might RNF19B be targeted therapeutically?

Potential therapeutic approaches targeting RNF19B include:

  • For cancer therapy (where RNF19B is downregulated):

    • Small molecule activators of RNF19B to enhance degradation of oncogenic substrates like RAC1

    • Gene therapy approaches to restore RNF19B expression

  • For immune modulation:

    • Inhibitors of RNF19B to dampen excessive innate immune responses

    • Activators to enhance NK cell and macrophage function against pathogens or tumors

  • Proteolysis-targeting chimeras (PROTACs):

    • Utilizing RNF19B's ability to ubiquitinate small molecules to develop novel targeted protein degradation technologies

    • Bifunctional compounds that recruit RNF19B to protein targets of interest

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.