Recombinant Mouse E3 ubiquitin-protein ligase RNF5 (Rnf5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
Rnf5; Ng2; E3 ubiquitin-protein ligase RNF5; RING finger protein 5; RING-type E3 ubiquitin transferase RNF5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-180
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
AAAEEEDGGPEGPNRERGGASATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPDR QECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDAGGFH FSFGVGAFPFGFFTTVFNAHEPFRRGAGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
Uniprot No.

Target Background

Function

Recombinant Mouse E3 ubiquitin-protein ligase RNF5 (Rnf5) exhibits E2-dependent E3 ubiquitin-protein ligase activity. It may function in conjunction with E2 ubiquitin-conjugating enzymes UBE2D1/UBCH5A and UBE2D2/UBC4. RNF5 mediates the ubiquitination of PXN/paxillin, potentially regulating cell motility and PXN/paxillin localization. Furthermore, it mediates Lys-63-linked polyubiquitination of JKAMP, modulating JKAMP function by reducing its association with proteasome and ERAD components. This ubiquitination appears to involve the E2 ubiquitin-conjugating enzyme UBE2N. Additionally, RNF5 mediates Lys-48-linked polyubiquitination of STING1 at Lys-150, leading to proteasomal degradation. This mitochondrial ubiquitination occurs post-viral transfection and regulates antiviral responses.

Gene References Into Functions
  1. RNF5-mediated control of membranal ATG4B reveals a novel regulatory layer in LC3 processing and autophagy. PMID: 23093945
  2. RNF5 regulates cell motility through paxillin ubiquitination and altered localization. PMID: 12861019
  3. The importance of RNF5 in muscle physiology and its deregulation in ER stress-associated muscular disorders. PMID: 18270596
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Mitochondrion membrane. Endoplasmic reticulum membrane. Note=Predominantly located in the plasma membrane, with some localization occurring within cytoplasmic organelles.

Q&A

What is RNF5 and what is its primary function in cellular biology?

RNF5 (Ring Finger Protein 5, also known as RMA1) is an E3 ubiquitin ligase primarily localized to the endoplasmic reticulum (ER). Its primary function involves the recognition and ubiquitination of misfolded proteins, targeting them for degradation through the ER-associated degradation (ERAD) pathway. RNF5 plays critical roles in:

  • Protein quality control within the endoplasmic reticulum

  • Regulation of cellular stress responses

  • Modulation of immune signaling pathways

  • Affecting the localization of cytoskeletal proteins, including paxillin

RNF5 functions by catalyzing the attachment of ubiquitin to target proteins, primarily through K48-linked ubiquitination, which marks proteins for proteasomal degradation . Methodologically, researchers can study RNF5 function through in vitro ubiquitination assays, protein interaction studies, and cellular localization experiments using fluorescence microscopy.

What are the key structural domains of RNF5 and how do they contribute to its function?

RNF5 contains several functional domains that are critical for its activity:

  • RING domain: Contains the catalytic C42 residue essential for E3 ligase activity

  • Transmembrane domain (TMD): Critical for proper ER localization and interactions with target proteins

  • C-terminal domain: Important for substrate recognition and protein-protein interactions

The RING domain is particularly crucial, as mutations in this region (such as the C42S mutation) abolish the E3 ligase activity while still allowing protein interactions . When investigating domain functions, researchers should:

  • Generate domain-specific deletion mutants

  • Create point mutations at key residues (especially C42)

  • Perform protein-protein interaction assays with each mutant

  • Compare ubiquitination activity between wild-type and mutant proteins

How can RNF5 expression and activity be detected in experimental systems?

Several methodological approaches can be employed to detect and measure RNF5:

Expression Analysis:

  • RT-qPCR for mRNA expression levels

  • Western blotting using anti-RNF5 antibodies

  • Immunofluorescence microscopy for cellular localization

Activity Assessment:

  • In vitro ubiquitination assays with recombinant proteins

  • Co-immunoprecipitation to detect RNF5-substrate complexes

  • Monitoring substrate protein levels following RNF5 manipulation

  • K48-linked ubiquitin chain-specific antibodies to detect RNF5-mediated ubiquitination

For accurate activity assessment, always include both wild-type RNF5 and the catalytically inactive C42S mutant as controls to distinguish between E3 ligase-dependent and independent effects .

What experimental approaches are most effective for studying RNF5's role in viral mechanisms, particularly SARS-CoV-2?

RNF5 has been identified as a critical factor in SARS-CoV-2 viral processes, with seemingly contradictory roles reported in different studies. To effectively investigate these roles:

Recommended Experimental Design:

  • Viral protein interaction studies:

    • Co-immunoprecipitation of RNF5 with viral proteins (M and E proteins)

    • Fluorescence co-localization studies

    • Bimolecular fluorescence complementation (BiFC) to confirm direct interactions

  • Ubiquitination analysis:

    • In vitro and in vivo ubiquitination assays using recombinant viral proteins

    • Mass spectrometry to identify ubiquitination sites (K15 on M protein, K63 on E protein)

    • Use ubiquitin mutants (K48-only, K63-only) to determine chain specificity

  • Functional assessment:

    • RNF5 knockdown/knockout in relevant cell lines (Caco2, Vero)

    • Complementation with wild-type or C42S mutant RNF5

    • Viral particle production assays (VLPs)

    • Viral titer measurements

    • Viral RNA quantification

The contrasting findings from studies showing RNF5 can either facilitate or restrict SARS-CoV-2 replication highlight the complexity of RNF5 functions, possibly reflecting context-dependent activities or targeting of different viral proteins.

Study FocusRNF5 Effect on SARS-CoV-2Target Viral ProteinUbiquitination SiteOutcome
Virion ReleaseFacilitatesM proteinK15Enhanced M-E interaction and autophagy induction
Viral ReplicationRestrictsE proteinK63Degradation of E protein

What are the optimal methods for generating and validating RNF5 knockout models?

Creating reliable RNF5 knockout models is crucial for studying its function. Based on the literature, the following approaches are recommended:

CRISPR/Cas9-mediated Knockout:

  • Design at least two gRNAs targeting early exons of RNF5

  • Use cell lines relevant to your research question (e.g., Caco2 cells for viral studies )

  • Confirm knockout through:

    • Western blotting for RNF5 protein

    • Genomic DNA sequencing to verify mutations

    • Functional assays (e.g., accumulation of known RNF5 substrates)

Functional Validation:

  • Compare phenotypes with RNF5 siRNA knockdown to rule out off-target effects

  • Perform rescue experiments by re-expressing RNF5 wild-type or C42S mutant

  • Examine key RNF5-dependent processes (ERAD, stress responses, viral replication)

Control Considerations:

  • Use littermate controls for mouse studies

  • Generate multiple independent knockout clones for cell line studies

  • Include both RNF5-expressing and RNF5-null conditions in all experiments

Researchers should be aware that complete RNF5 knockout might affect multiple cellular pathways, potentially complicating data interpretation. Inducible knockout systems may provide more controlled experimental conditions.

How does RNF5 regulate immune signaling pathways, and what experimental approaches best capture this function?

RNF5 plays critical roles in regulating innate immune responses, particularly antiviral signaling pathways. Several experimental approaches can effectively study these functions:

Key Immune Targets of RNF5:

  • STING (stimulator of interferon genes)

  • MAVS (mitochondrial antiviral signaling protein)

  • IRF3 (interferon regulatory factor 3)

RNF5 typically mediates K48-linked ubiquitination of these proteins, targeting them for proteasomal degradation and thereby limiting type I interferon responses .

Recommended Experimental Approaches:

  • Pathway activation analysis:

    • Measure IRF3 phosphorylation and nuclear translocation

    • Quantify type I interferon production (ELISA, reporter assays)

    • Analyze interferon-stimulated gene expression (RT-qPCR, RNA-seq)

  • Ubiquitination studies:

    • Immunoprecipitate target proteins (STING, MAVS) followed by ubiquitin immunoblotting

    • Use linkage-specific antibodies to distinguish K48 from K63 ubiquitination

    • Employ ubiquitin mutants (K48R, K63R) to confirm chain specificity

  • Protein stability measurements:

    • Cycloheximide chase assays to determine protein half-life

    • Proteasome inhibitors (MG132) to confirm degradation mechanism

    • Compare wild-type cells with RNF5-deficient models

In various species including fish, RNF5 has been shown to facilitate K48-linked ubiquitination of STING, promoting its proteasomal degradation and subsequently suppressing interferon responses . This conservation across species highlights the evolutionary importance of this regulatory mechanism.

What are the effects and applications of RNF5 small-molecule inhibitors in research settings?

Small-molecule inhibitors of RNF5, such as FX12, provide valuable tools for studying RNF5 function. Based on the literature, these compounds offer several research applications:

FX12 as an RNF5 Inhibitor and Degrader:

  • FX12, a benzo[b]thiophene derivative, acts as both an inhibitor and degrader of RNF5

  • Selectively binds to RNF5 and inhibits its E3 ligase activity in vitro

  • Promotes proteasomal degradation of RNF5 in cells after extended treatment (>9 hours)

Experimental Applications:

  • Acute vs. chronic inhibition:

    • Short-term treatment (<6 hours): Inhibits RNF5 E3 activity without protein degradation

    • Long-term treatment (>9 hours): Leads to RNF5 protein degradation

  • Mechanistic studies:

    • Use FX12 to distinguish between E3 ligase-dependent and scaffold functions

    • Combine with proteasome or p97/VCP inhibitors to understand degradation mechanisms

    • Compare FX12 effects with RNF5 knockout to identify potential off-target effects

  • Pathway analysis:

    • Monitor accumulation of RNF5 substrates after inhibitor treatment

    • Assess changes in protein-protein interactions (e.g., enhanced RNF5-Derlin1 interaction)

    • Evaluate effects on ER stress and unfolded protein response

When using small-molecule inhibitors, researchers should include appropriate controls such as inactive analogs and compare results with genetic approaches (siRNA, CRISPR) to confirm target specificity.

How does RNF5 contribute to cardiovascular pathophysiology, and what methods are most appropriate for studying these effects?

Recent research has identified RNF5 as a protective factor in myocardial infarction (MI), suggesting new avenues for cardiovascular research . To effectively study RNF5's role in cardiovascular contexts:

Experimental Models:

  • In vivo approaches:

    • RNF5 knockout mice created through CRISPR-mediated genome editing

    • Left anterior descending (LAD) artery ligation to induce MI

    • Echocardiography to assess cardiac function

    • Histological analysis to measure infarct size and tissue remodeling

  • Cellular models:

    • Primary cardiomyocytes with RNF5 overexpression or knockdown

    • Hypoxia-reoxygenation protocols to simulate ischemia-reperfusion

    • Assessment of cell viability, apoptosis, and oxidative stress

Molecular Mechanisms:

  • RNF5 appears to protect against MI by inhibiting the activation of ASK1 (Apoptosis Signal-regulating Kinase 1)

  • This represents a novel function distinct from its established roles in ERAD and immune regulation

Analytical Approaches:

  • Western blotting for ASK1 phosphorylation status

  • Co-immunoprecipitation to detect RNF5-ASK1 interaction

  • Ubiquitination assays to determine if ASK1 is a direct ubiquitination target of RNF5

  • Transcriptomic analysis to identify affected pathways

These approaches can help elucidate whether RNF5's protective effect in MI is primarily mediated through its E3 ligase activity or through other mechanisms.

What are the optimal conditions for expressing and purifying recombinant mouse RNF5 protein?

Producing functional recombinant RNF5 presents several challenges due to its transmembrane domain and tendency for aggregation. Based on the literature, the following approaches are recommended:

Expression Systems:

  • E. coli: Suitable for truncated versions (RING domain only)

  • Insect cells: Preferred for full-length protein with proper folding

  • Mammalian cells: Optimal for functional studies requiring post-translational modifications

Purification Strategy:

  • Use N-terminal tags (His6 or GST) for affinity purification

  • Include detergents (0.1% NP-40 or 0.05% DDM) to maintain solubility

  • Add reducing agents (1-5 mM DTT) to prevent disulfide bond formation

  • Perform purification at 4°C to minimize protein degradation

  • Consider on-column cleavage of affinity tags to improve final protein quality

Functional Validation:

  • In vitro autoubiquitination assay to confirm E3 ligase activity

  • Circular dichroism to assess proper protein folding

  • Size-exclusion chromatography to verify monodispersity

  • Thermal shift assays to optimize buffer conditions

When designing experiments with recombinant RNF5, always include the catalytically inactive C42S mutant as a negative control .

What methods are most effective for analyzing RNF5-mediated ubiquitination of target proteins?

Analyzing RNF5-mediated ubiquitination requires careful experimental design to distinguish between different ubiquitin chain types and their functional consequences. The following approaches are recommended:

In Vitro Ubiquitination Assays:

  • Reconstitute the ubiquitination cascade using:

    • Purified E1 (UBA1)

    • E2 enzyme (typically UBE2D family)

    • Recombinant RNF5 (wild-type and C42S mutant)

    • Purified substrate protein

    • Ubiquitin (wild-type or mutants)

    • ATP regeneration system

  • Analyze reaction products by:

    • Western blotting with substrate-specific and ubiquitin antibodies

    • Mass spectrometry to identify precise ubiquitination sites

Cellular Ubiquitination Analysis:

  • Transfect cells with:

    • His-tagged ubiquitin or ubiquitin mutants (K48-only, K63-only)

    • RNF5 (wild-type or C42S)

    • Substrate protein of interest

  • Perform denaturing Ni-NTA pulldown or immunoprecipitation under denaturing conditions

  • Detect ubiquitinated species by Western blotting

Chain-Specific Analysis:

  • Use linkage-specific antibodies (anti-K48, anti-K63) to identify chain types

  • Employ ubiquitin mutants with single lysine residues (K6, K11, K27, K29, K33, K48, K63) to determine chain specificity

  • Analyze ubiquitination sites by creating lysine-to-arginine mutations in substrate proteins

Research has shown that RNF5 primarily catalyzes K48-linked ubiquitination of target proteins such as the SARS-CoV-2 E protein at K63 and STING, marking them for proteasomal degradation.

How can researchers effectively design experiments to resolve contradictory findings regarding RNF5 function?

The scientific literature contains seemingly contradictory findings regarding RNF5 function, particularly in viral contexts. Resolving these contradictions requires careful experimental design:

Potential Sources of Contradiction:

FactorConsiderationApproach
Cell typeRNF5 may function differently in distinct cellular contextsUse multiple cell lines relevant to the biological question
Substrate specificityRNF5 targets different proteins in different contextsExamine multiple potential substrates simultaneously
Experimental timingAcute vs. chronic effects of RNF5 manipulationInclude multiple time points in experimental design
Viral strain differencesDifferent viral variants may interact differently with RNF5Test multiple viral strains or isolates

Recommended Strategies:

  • Comprehensive controls:

    • Include both gain-of-function (overexpression) and loss-of-function (knockout/knockdown) approaches

    • Use the catalytically inactive C42S mutant to distinguish E3 ligase-dependent and independent functions

    • Compare results from multiple experimental systems

  • Targeted mechanistic dissection:

    • For contradictory findings regarding SARS-CoV-2, separately examine RNF5's effect on:

      • M protein ubiquitination at K15

      • E protein ubiquitination at K63

      • Viral release mechanisms

      • Viral replication

  • Direct comparison studies:

    • Replicate key experiments from contradictory studies in parallel

    • Standardize experimental conditions where possible

    • Consider collaboration with authors of contradictory studies

For example, in SARS-CoV-2 research, one study found RNF5 facilitates viral release by ubiquitinating the M protein , while another reported RNF5 restricts viral replication by targeting the E protein for degradation . These findings might both be correct but reflect different aspects of RNF5 function during the viral life cycle.

What is known about RNF5's role in disease models, and what research methods best capture its therapeutic potential?

RNF5 has been implicated in multiple disease models, and understanding its role could reveal therapeutic opportunities. The following disease contexts and research approaches are particularly relevant:

Disease Contexts:

  • Viral infections:

    • SARS-CoV-2: RNF5 shows dual roles in viral processes

    • Herpes simplex virus: RNF5 inhibits STING/IRF3 signaling in keratitis

    • Newcastle disease virus: V protein recruits RNF5 to degrade MAVS

  • Cardiovascular disease:

    • Myocardial infarction: RNF5 shows protective effects by inhibiting ASK1 activation

  • Other conditions mentioned in literature:

    • Cystic fibrosis

    • Acute myeloid leukemia

    • Muscular dystrophies

Research Approaches:

  • Disease-specific animal models:

    • RNF5 knockout or transgenic mice in relevant disease models

    • Tissue-specific or inducible RNF5 modulation to avoid developmental effects

  • Therapeutic targeting strategies:

    • Small-molecule inhibitors like FX12

    • Structure-based drug design targeting specific RNF5 domains

    • Substrate-specific intervention approaches

  • Biomarker development:

    • Evaluate RNF5 expression levels in disease states

    • Identify downstream effects that could serve as biomarkers

    • Develop assays for RNF5 activity in clinical samples

Experimental Design Considerations:

  • Include both male and female subjects to account for potential sex differences

  • Assess both acute and chronic effects of RNF5 modulation

  • Consider time-course experiments to capture dynamic changes

The development of small-molecule RNF5 modulators like FX12 provides valuable tools for exploring therapeutic potential, particularly in contexts where specific RNF5 functions need to be targeted.

How can researchers effectively study the cross-talk between RNF5 and other E3 ligases in regulatory networks?

RNF5 functions within a complex network of E3 ubiquitin ligases that often exhibit overlapping substrates and compensatory mechanisms. Studying these interactions requires sophisticated approaches:

Network Analysis Strategies:

  • Identification of functional redundancy:

    • Generate single and double knockout models of RNF5 with related E3 ligases

    • Perform synthetic lethality screens to identify genetic interactions

    • Compare ubiquitination profiles in single vs. double knockout systems

  • Substrate competition studies:

    • In vitro competition assays with purified E3 ligases

    • Quantitative proteomics to identify differentially regulated substrates

    • Proximity labeling (BioID, APEX) to map E3 ligase interactomes

  • Regulatory interaction mapping:

    • Investigate whether RNF5 directly regulates other E3 ligases via ubiquitination

    • Examine co-regulation of RNF5 with other E3 ligases

    • Study physical interactions between different E3 complexes

Relevant E3 Ligase Interactions:

  • Hrd1: Evidence suggests functional interactions in ERAD pathways

  • Potential cross-talk with STING/MAVS regulators in immune signaling

Analytical Approaches:

  • Systems biology modeling of E3 ligase networks

  • Temporal analysis of E3 ligase activity during cellular responses

  • Multi-omics integration (proteomics, transcriptomics, interactomics)

Understanding these intricate E3 ligase networks will help explain seemingly contradictory findings and potentially identify more precise therapeutic intervention points.

What emerging technologies and approaches might advance RNF5 research in the coming years?

Several cutting-edge technologies hold promise for deepening our understanding of RNF5 biology:

Emerging Technologies:

  • Proximity-based proteomics:

    • BioID, TurboID, or APEX2 fusions with RNF5 to identify transient interactions

    • Substrate trapping approaches using catalytically inactive RNF5 mutants

    • Quantitative interactomics under different cellular conditions

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize RNF5 at the ER membrane

    • Live-cell imaging with fluorescent ubiquitin sensors

    • Correlative light and electron microscopy for ultrastructural analysis

  • CRISPR-based screening:

    • Genome-wide CRISPR screens to identify synthetic lethal interactions with RNF5

    • CRISPRi/CRISPRa approaches for temporal control of RNF5 expression

    • Base editing or prime editing for precise modification of RNF5 regulatory elements

  • Structural biology advances:

    • Cryo-EM structures of RNF5 complexes

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Integrative structural biology combining multiple techniques

Promising Research Directions:

  • Development of substrate-specific inhibitors:

    • Focus on disrupting specific RNF5-substrate interactions rather than general E3 activity

    • Structure-based design of peptide or small-molecule inhibitors

    • Targeted protein degradation approaches (PROTACs) directed at RNF5

  • Tissue-specific functions:

    • Single-cell analysis of RNF5 expression and activity across tissues

    • Organ-specific knockout models to address tissue-specific roles

    • Organoid models to study RNF5 in complex tissue environments

  • Therapeutic applications:

    • Further development of small-molecule modulators like FX12

    • Investigation of RNF5's protective role in myocardial infarction

    • Exploration of context-dependent activities in viral infections

These emerging approaches will help resolve current contradictions in the field and potentially reveal new applications for RNF5-targeting therapeutics.

What are the key unresolved questions in RNF5 biology that researchers should prioritize?

Despite significant advances, several fundamental questions about RNF5 biology remain unresolved and represent important areas for future research:

Critical Unresolved Questions:

  • Substrate specificity mechanisms:

    • How does RNF5 recognize such diverse substrates?

    • What determines substrate selection in different cellular contexts?

    • Are there co-factors that direct RNF5 to specific targets?

  • Regulatory mechanisms:

    • How is RNF5 itself regulated at transcriptional, translational, and post-translational levels?

    • What triggers RNF5 autoubiquitination and degradation?

    • Are there feedback loops controlling RNF5 activity?

  • Context-dependent functions:

    • Why does RNF5 appear to have opposing effects in different experimental settings?

    • How do cell type, disease state, and environmental factors influence RNF5 function?

    • What explains RNF5's seemingly contradictory roles in viral processes?

  • Evolutionary conservation and divergence:

    • How are RNF5 functions conserved across species from fish to mammals?

    • Are there species-specific substrates or regulatory mechanisms?

    • What can comparative studies reveal about essential vs. specialized functions?

Methodological Approaches to Address These Questions:

  • Comprehensive substrate identification:

    • Ubiquitinome analysis comparing wild-type and RNF5-deficient systems

    • Proximity labeling combined with mass spectrometry

    • In vitro ubiquitination screens with protein arrays

  • Mechanism-focused studies:

    • Structure-function analysis of RNF5 domains

    • Dissection of the RNF5 interactome in different cellular contexts

    • Temporal analysis of RNF5 activity during cellular responses

  • Integrative multi-omics:

    • Combined analysis of transcriptome, proteome, and ubiquitinome

    • Network modeling of RNF5-centered regulatory systems

    • Machine learning approaches to identify patterns across datasets

Addressing these questions will require interdisciplinary approaches and potentially collaborative efforts across research groups with complementary expertise.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.