Recombinant Mouse E3 ubiquitin-protein ligase synoviolin (Syvn1)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Mechanisms

Recombinant Syvn1 is utilized to investigate its biological functions, which include:

Key Substrates and Pathways

SubstrateBiological ImpactMechanism
PGC-1βRegulates mitochondrial biogenesis and energy expenditure; Syvn1 ubiquitinates PGC-1β, targeting it for proteasomal degradation
HSP90/EEF2KPromotes hepatocellular carcinoma (HCC) metastasis by modulating kinase activity and ubiquitination
Misfolded ER proteinsMediates ER-associated degradation (ERAD) to maintain proteostasis

In adipose tissue, Syvn1 deficiency increases mitochondrial respiration and reduces obesity in murine models, highlighting its role in metabolic regulation .

Research Applications

Recombinant Syvn1 enables diverse experimental approaches:

Experimental Uses

  • In vitro ubiquitination assays: Validating E3 ligase activity using substrates like PGC-1β .

  • Protein interaction studies: Identifying binding partners (e.g., HSP90) via co-immunoprecipitation .

  • Therapeutic screening: Testing inhibitors (e.g., LS-102) that block Syvn1 activity to combat obesity .

Disease Models

ModelFindings
Genetically obese (ob/ob, db/db) miceSyvn1 knockout reduces adiposity and enhances energy expenditure
HCC xenograftsSyvn1 knockdown suppresses tumor growth and metastasis by stabilizing EEF2K

Therapeutic Potential

Syvn1 is a promising target for metabolic and oncological diseases:

Preclinical Insights

  • Obesity: Inhibition with LS-102 prevents weight gain in mice by upregulating PGC-1β and mitochondrial activity .

  • Cancer: Targeting Syvn1 disrupts HSP90-EEF2K signaling, reducing HCC metastasis .

Challenges

  • Tissue-specific effects require careful modulation to avoid off-target ER stress .

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format we have in stock. However, if you have any special requirements for the format, please specify them when placing your order. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that tag.
Synonyms
Syvn1; Hrd1; Kiaa1810; E3 ubiquitin-protein ligase synoviolin; RING-type E3 ubiquitin transferase synoviolin; Synovial apoptosis inhibitor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-612
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
YYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKVMGKVFFGQLRAAEMEHLLERSW YAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLAEDRVDFMERSPNISWLFHCRIV SLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAILMTMVLTIFIKYVLHSVDLQSE NPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTFPLFAIRPMYLAMRQFKKAVTDA IMSRRAIRNMNTLYPDATPEELQAVDNVCIICREEMVTGAKRLPCNHIFHTSCLRSWFQR QQTCPTCRMDVLRASLPAQSPPPPEPADQGPPPAPHPQPLLPQPPNFPQGLLPPFPPGMF PLWPPMGPFPPVPPPPSSGEAAAPPPTSTAVSRPSGAATTTAAGTSTSAPAPGSVPGPEA GPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLR NIHTLLDAAMLQINQYLTVLASLGPPRPATSVNPTEETASTVVSAAPSTSAPSSEAPTPS PGASPPIPEAEKPPAPESVGIVEELPEDGEPDAAELRRRRLQKLESPVAH
Uniprot No.

Target Background

Function
E3 ubiquitin-protein ligase that accepts ubiquitin specifically from endoplasmic reticulum-associated UBC7 E2 ligase and transfers it to substrates, promoting their degradation. It is a component of the endoplasmic reticulum quality control (ERQC) system, also known as ER-associated degradation (ERAD), involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. It also promotes the degradation of normal but naturally short-lived proteins such as SGK. Synoviolin protects cells from ER stress-induced apoptosis. It sequesters p53/TP53 in the cytoplasm and promotes its degradation, thereby negatively regulating its biological function in transcription, cell cycle regulation, and apoptosis. It is essential for embryogenesis. Synoviolin mediates the ubiquitination and subsequent degradation of cytoplasmic NFE2L1. During the early stage of B cell development, it is required for the degradation of the pre-B cell receptor (pre-BCR) complex, supporting further differentiation into mature B cells.
Gene References Into Functions
  1. The KAT4 promoter was significantly activated by the transcriptional factors, NFE2related factor 2 and peroxisome proliferator-activated receptor coactivator 1beta, which are targets of Syvn1-induced degradation. PMID: 29916549
  2. Hrd1 is a positive regulator of T cells. Hrd1 is required for T-cell activation and differentiation. PMID: 27417417
  3. HRD1 prevents apoptosis in renal tubular epithelial cells by mediating eIF-2a ubiquitylation and degradation. PMID: 29233968
  4. Amyloid beta oligomers modulate BACE1 through an XBP-1-dependent pathway involving HRD1. PMID: 27853315
  5. Hrd1-null B cells exhibited high Fas expression during activation and rapidly underwent Fas-mediated apoptosis, which could be largely inhibited by FasL neutralization. Fas mutation in Hrd1 KO mice abrogated the increase in B-cell AICD. We identified Hrd1 as the first E3 ubiquitin ligase of the death receptor Fas and Hrd1-mediated Fas destruction as a molecular mechanism in regulating B-cell immunity. PMID: 27573825
  6. This study proved that SYVN1 enhances SERPINA1(E342K)/ATZ degradation through SQSTM1-dependent autophagy and attenuates SERPINA1(E342K)/ATZ cytotoxicity. PMID: 28121484
  7. This study implicates Endoplasmic reticulum (ER)-associated degradation mediated by Sel1L-Hrd1 as a key regulator of B cell development. PMID: 27568564
  8. SYVN1 may play an important role in inhibiting ER stress, chronic inflammation, and vascular overgrowth associated with DR. PMID: 26358086
  9. Data show that inositol requiring enzyme 1alpha (IRE1alpha), the sensor of the unfolded protein response (UPR), is a bona fide substrate of the Sel1L proten-Hrd1 protein endoplasmic reticulum (ER)-associated degradation (ERAD) complex. PMID: 26551274
  10. Hrd1 is an essential component of the adaptive endoplasmic reticulum stress response in cardiac myocytes. PMID: 26137860
  11. The results highlight a novel function for SYVN1 in the control of body weight and mitochondrial biogenesis through negative regulation of PGC-1b. PMID: 25698262
  12. Data indicate that E3 ubiquitin-protein ligase Hrd1 catalyzed ubiquitination and degradation of the transcriptional suppressor B lymphocyte-induced maturation protein 1 (BLIMP1) to promote MHC-II antigen expression. PMID: 25366967
  13. Oxidative stress-induced HRD1 insolubilization might be involved in a vicious cycle of increased amyloid beta production and amyloid beta-induced oxidative stress in Alzheimer's disease pathogenesis. PMID: 24788773
  14. Results indicate that Hrd1 plays an important role in the maturation of collagen I in renal fibrosis, and that the Sec23A pathway is required for ER-to-Golgi procollagen trafficking to promote collagen synthesis. PMID: 24114659
  15. Synoviolin up-regulates amyloid beta production by targeting a negative regulator of gamma-secretase, Rer1, for degradation. PMID: 23129766
  16. HRD1 is colocated with the neural stem cell marker protein nestin and glial fibrillary acidic protein in the endoplasmic reticulum membrane of the NSCs of the subventricular zone (SVZ astrocytes) but in the cell nucleus of the dentate gyrus. PMID: 22027098
  17. These results clearly suggest that both beta-TrCP- and Hrd1-dependent degradation mechanisms regulate the transcriptional activity of Nrf1 to maintain cellular homeostasis. PMID: 21911472
  18. IL-17 induction of synoviolin may contribute at least in part to RA chronicity by prolonging the survival of RA FLS and immune cells in germinal center reactions. PMID: 20976214
  19. Collagen expression in LX-2 cells was upregulated by synoviolin overexpression, while synoviolin knockdown led to reduced collagen expression. PMID: 21049091
  20. Synoviolin has an indispensable role in embryogenesis. PMID: 15611074
  21. Transcriptional regulation of synoviolin via EBS-1 (ETS binding site) plays an important role in cellular homeostasis. PMID: 16055742
  22. HRD1 immunoreactivity was detected in the neuronal cells but not in the glial cells of the brain. PMID: 18241051
  23. Hrd1 promotes IRE1 ubiquitination and degradation in synovial fibroblasts from mice with collagen-induced arthritis. PMID: 18369366
  24. Synoviolin-mediated ubiquitination is involved in the degradation of immature nicastrin and likely regulates amyloid beta-protein generation. PMID: 19725872
  25. Review. In addition to its canonical role in endoplasmic-reticulum-associated degradation, synoviolin targets the tumor suppressor gene p53 for proteasomal degradation, suggesting crosstalk between ERAD and p53-mediated apoptotic pathways under ER stress. PMID: 17582219

Show More

Hide All

Database Links
Protein Families
HRD1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed, with highest levels in bone, spleen, lung and testis. In the brain, present in neurons but not in glial cells. Up-regulated in synovial tissues from mice with collagen-induced arthritis (at protein level). Expressed in the liver.

Q&A

What is Syvn1 and what are its primary biological functions?

Syvn1 (Synovial apoptosis inhibitor 1) is an E3 ubiquitin ligase localized in the endoplasmic reticulum (ER) that plays a central role in the endoplasmic reticulum-associated degradation (ERAD) pathway. Its primary functions include:

  • Facilitating degradation of misfolded proteins through the ubiquitin-proteasome system

  • Promoting cell survival through anti-apoptotic effects

  • Regulating ER stress responses by removing aberrant proteins

  • Mediating specific substrate degradation as part of protein quality control mechanisms

Molecularly, Syvn1 contains a RING finger domain that is essential for its ubiquitin ligase activity, enabling transfer of ubiquitin to substrate proteins and marking them for proteasomal degradation . This activity was confirmed through in vitro ubiquitination assays using recombinant GST-Synoviolin/Hrd1 ΔTM and its mutants, demonstrating that the RING finger domain is crucial for proper ligase function .

How does Syvn1 expression differ between normal and pathological conditions?

  • Rheumatoid Arthritis (RA): Syvn1 is highly overexpressed in rheumatoid synovium compared to normal synovial tissue, contributing to synovial hyperplasia . Immunohistological analysis using anti-RSCs polyclonal antibody revealed strong Syvn1 reactivity in rheumatoid synovia but minimal expression in healthy controls .

  • Neurodegenerative Conditions: Dysregulation of Syvn1 has been observed in various neurological disorders, affecting protein degradation pathways.

  • Drug Addiction Models: In methamphetamine (METH) conditioned place preference (CPP) rat models, Syvn1 expression significantly increases in the dorsal striatum, coinciding with reduced GABA Aα1 receptor levels .

These expression differences highlight Syvn1's contextual role in disease progression, providing a basis for therapeutic targeting.

What are effective approaches for manipulating Syvn1 expression in experimental systems?

RNA Interference (RNAi) Methods:

  • siRNA duplexes can achieve complete repression of Synoviolin/Hrd1 expression in rheumatoid synovial cells (RSCs)

  • Lentiviral vectors expressing SYVN1-targeted shRNA effectively reduce SYVN1 expression in primary striatum neurons

  • AAV-SYVN1 can be used for in vivo knockdown in specific brain regions with high transduction efficiency

Overexpression Systems:

  • Plasmid transfection for transient overexpression in cell lines

  • Transgenic mice overexpressing Synoviolin/Hrd1 show phenotypes relevant to arthritis research

Experimental Validation:
When using these approaches, protein levels should be verified by Western blot analysis. For example, SYVN1 knockdown in primary neurons showed approximately 80% reduction in protein expression compared to controls . Visualization of transduction efficiency can be achieved through fluorescent markers, as demonstrated in Figure 3D and 3G of the referenced study .

How can researcher identify and validate Syvn1 substrates?

Identifying and validating Syvn1 substrates requires multiple complementary approaches:

Co-immunoprecipitation (Co-IP):

  • Prepare lysates from tissues or cells of interest

  • Perform Co-IP using anti-Syvn1 antibody followed by western blotting for candidate substrates

  • Conduct reciprocal Co-IP with substrate antibody followed by Syvn1 detection

  • Include appropriate IgG controls to confirm specificity

This approach successfully identified the interaction between SYVN1 and GABA Aα1 in the dorsal striatum, where both proteins co-precipitated in reciprocal immunoprecipitation experiments .

Degradation Assays:

  • Knockdown Syvn1 using RNAi and measure substrate protein levels

  • Treat cells with proteasome inhibitors (MG132, Lactacystin) to confirm proteasome-dependent degradation

  • Compare substrate levels in different cellular compartments (e.g., intra-ER vs. extra-ER fractions)

When SYVN1 was knocked down in primary neurons, GABA Aα1 protein levels increased significantly, and similar effects were observed with proteasome inhibitors, confirming GABA Aα1 as a substrate of SYVN1-mediated degradation .

Ubiquitination Assays:

  • Perform in vitro ubiquitination using purified components (E1, E2, Syvn1, substrate)

  • Detect ubiquitinated species using 32P-labeled ubiquitin

  • Include control reactions with mutated Syvn1 lacking catalytic activity

The ubiquitin ligase activity of Synoviolin/Hrd1 was confirmed using recombinant GST-Synoviolin/Hrd1 ΔTM and various RING domain mutants in combination with E1, UbcH5c (E2), and 32P-labeled ubiquitin .

What methodological considerations are important when investigating Syvn1's role in ER stress responses?

When studying Syvn1's function in ER stress responses, researchers should consider:

ER Stress Induction Methods:

  • Pharmacological inducers (tunicamycin, thapsigargin) that disrupt protein folding

  • Glucose deprivation

  • Expression of misfolding-prone proteins (e.g., SERPINA1 E342K/ATZ)

Key ER Stress Markers to Monitor:

  • GRP78/BiP (master regulator of ER stress)

  • CHOP (pro-apoptotic transcription factor)

  • XBP1 splicing (indicator of IRE1 pathway activation)

Experimental Design Considerations:

  • Include time-course experiments to capture dynamic changes

  • Separate analyses of different ER stress response pathways (PERK, IRE1, ATF6)

  • Combine with Syvn1 knockdown or overexpression

In SYVN1 knockdown experiments, researchers observed increased GRP78 and CHOP expression, suggesting that SYVN1 reduction leads to enhanced ER stress responses . This provides evidence that Syvn1 plays a protective role against ER stress by facilitating the degradation of misfolded proteins.

How does Syvn1 contribute to rheumatoid arthritis pathogenesis?

Syvn1 plays a crucial role in rheumatoid arthritis (RA) pathogenesis through multiple mechanisms:

Anti-apoptotic Effects:

  • Syvn1 inhibits apoptosis of synovial cells, promoting their hyperproliferation

  • Synoviolin/Hrd1 heterozygous (Syno+/-) mice show enhanced apoptosis of synovial cells and resistance to collagen-induced arthritis

  • Only 7% of Syno+/- mice developed arthritis compared to 65% of wild-type mice

Synovial Cell Outgrowth:

  • Suppression of Synoviolin/Hrd1 by siRNA completely inhibited rheumatoid synovial cell growth

  • Even under pro-inflammatory stimulation with TNFα and IL-1β, Synoviolin/Hrd1 knockdown prevented abnormal cell proliferation

ER Stress Modulation:

  • Synoviolin/Hrd1 protects synovial cells from ER stress-induced apoptosis

  • Knockdown of Synoviolin/Hrd1 enhanced susceptibility to tunicamycin-induced apoptosis (66.3 ± 15.5% in knockdown cells vs. 26.3 ± 5.5% in control cells)

These findings suggest that targeting Synoviolin/Hrd1 could represent a novel therapeutic strategy for RA by promoting apoptosis of hyperplastic synovial cells.

What is the role of Syvn1 in protein quality control pathways related to neurodegenerative disorders?

Syvn1 functions as a critical component in protein quality control pathways with implications for neurodegenerative conditions:

ERAD Pathway Regulation:

  • Syvn1 facilitates degradation of misfolded proteins in the ER

  • It recognizes misfolded proteins, catalyzes their ubiquitination, and directs them to proteasomal degradation

Alpha-1 Antitrypsin Processing:

  • Syvn1/HRD1 facilitates degradation of the misfolded SERPINA1/AAT E342K variant (ATZ)

  • This process involves recognition of the mutant protein in the ER and targeting it for degradation

Neurotransmitter Receptor Regulation:

  • Syvn1 interacts directly with GABA Aα1 receptors in the dorsal striatum

  • In methamphetamine conditioning models, increased Syvn1 corresponds with decreased GABA Aα1 expression

  • Knockdown of SYVN1 increased GABA Aα1 protein levels in both primary cultured neurons and in vivo in the dorsal striatum

Understanding these mechanisms provides insight into how dysregulation of Syvn1 might contribute to neurodegenerative disorders characterized by protein misfolding and aggregation.

How does Syvn1 relate to addiction mechanisms in the brain?

Recent research has revealed unexpected connections between Syvn1 and addiction mechanisms:

GABAergic System Modulation:

  • SYVN1 regulates GABA Aα1 receptor levels through direct interaction and degradation

  • Co-immunoprecipitation experiments confirmed physical interaction between SYVN1 and GABA Aα1 in the dorsal striatum

Methamphetamine-Induced Adaptations:

  • Methamphetamine conditioning significantly increases SYVN1 expression in the dorsal striatum

  • This increase coincides with reduction of GABA Aα1 expression, potentially contributing to reward-related neural adaptations

  • Figure 2A in the referenced study shows approximately 25% increase in SYVN1 protein levels in the dorsal striatum following METH-CPP formation

Potential Therapeutic Implications:

  • Targeting SYVN1 might restore normal GABA Aα1 levels in addiction states

  • SYVN1 knockdown increased GABA Aα1 protein levels, which could potentially normalize inhibitory neurotransmission disrupted by drug exposure

These findings suggest that SYVN1 may represent a novel target for addressing addiction-related neuroadaptations through its regulation of inhibitory neurotransmission.

What are emerging techniques for temporal and spatial control of Syvn1 activity?

Advanced research on Syvn1 requires sophisticated tools for precise manipulation:

Inducible Expression Systems:

  • Tetracycline-regulated promoters for temporal control of Syvn1 expression

  • Tamoxifen-inducible Cre-loxP systems for conditional knockouts

  • These approaches circumvent embryonic lethality observed in Synoviolin/Hrd1 homozygous knockout mice

Viral Vector-Based Approaches:

  • Region-specific delivery of AAV vectors expressing SYVN1 shRNA for spatial control

  • Lentiviral vectors for transduction of primary neurons or specific cell populations

  • These methods have shown high efficiency, as demonstrated by fluorescence microscopy verification of transduction (Figure 3D and 3G)

Structure-Function Modulation:

  • RING finger domain mutations that specifically disrupt ubiquitin ligase activity

  • C307S, H309E, and C329S mutations of the RING finger domain can be used to create catalytically inactive Syvn1 for mechanistic studies

  • These targeted mutations allow dissection of ubiquitin ligase-dependent versus scaffolding functions

These advanced techniques allow researchers to isolate specific aspects of Syvn1 function in complex biological systems.

How can researchers study the dynamics of Syvn1-substrate interactions in real-time?

Real-time analysis of Syvn1-substrate interactions requires specialized approaches:

Fluorescence-Based Techniques:

  • Förster Resonance Energy Transfer (FRET) using fluorescently-tagged Syvn1 and substrates

  • Fluorescence Recovery After Photobleaching (FRAP) to measure turnover rates

  • Fluorescence Correlation Spectroscopy (FCS) for measuring diffusion and binding kinetics

Dual-Color Tracking Systems:

  • mCherry-GFP dual tagging systems can track protein degradation through distinct cellular compartments

  • As demonstrated with mCherry-GFP-SERPINA1 E342K/ATZ, this approach allows visualization of acidic (red-only) versus neutral (yellow) compartments during the degradation process

  • This method revealed that approximately 38% of structures were red-only in SYVN1-expressing cells, representing proteins in acidic vesicles

Live Cell Imaging with Proteasome Sensors:

  • Fluorescent proteasome activity reporters

  • Real-time monitoring of substrate ubiquitination and degradation

  • Integration with Syvn1 knockdown or overexpression experiments

These approaches enable visualization of the dynamic processes involved in Syvn1-mediated protein quality control and degradation.

What computational approaches can predict novel Syvn1 substrates and interaction partners?

Computational methods are increasingly valuable for identifying potential Syvn1 substrates:

Sequence-Based Prediction:

  • Machine learning algorithms trained on known ERAD substrates

  • Identification of degron motifs or structural features recognized by Syvn1

  • Consensus sequence analysis of verified substrates (e.g., GABA Aα1, SERPINA1)

Protein-Protein Interaction Networks:

  • Integration of proteomic data with interactome databases

  • Network analysis to identify potential Syvn1 interactors based on known associations

  • Prioritization of candidates based on subcellular localization and functional relevance

Structural Modeling:

  • Molecular docking simulations between Syvn1 and potential substrates

  • Homology modeling of substrate recognition domains

  • MD simulations to predict stable interaction interfaces

These computational approaches can generate testable hypotheses about novel Syvn1 substrates, guiding experimental validation through the biochemical methods described in earlier sections.

How can specificity issues in Syvn1 knockout or knockdown experiments be addressed?

Ensuring specificity in Syvn1 manipulation experiments requires careful controls and validation:

siRNA Off-Target Effects:

  • Use multiple siRNA sequences targeting different regions of SYVN1 mRNA

  • Include non-targeting siRNA controls (e.g., siRNA for GFP as used in referenced studies)

  • Rescue experiments by co-expressing siRNA-resistant Syvn1 constructs

Viral Vector Considerations:

  • Titrate viral vectors to minimize toxicity while maintaining knockdown efficiency

  • Confirm transduction efficiency through reporter gene expression (as shown in Figures 3D and 3G)

  • Use appropriate control vectors with scrambled sequences

Validation of Knockdown:

  • Quantify both mRNA (RT-qPCR) and protein (Western blot) levels

  • Assess functional consequences through established readouts (e.g., increased substrate levels)

  • In the referenced study, SYVN1 knockdown produced approximately 80% reduction in protein levels, which was sufficient to observe significant effects on GABA Aα1 expression

These measures help ensure that observed phenotypes genuinely reflect Syvn1 function rather than experimental artifacts.

What are critical controls for ubiquitination assays involving Syvn1?

Robust ubiquitination assays require several key controls:

Enzyme Controls:

  • Omit E1, E2, or E3 (Syvn1) individually to confirm requirement of each component

  • Include catalytically inactive Syvn1 mutants (e.g., C307S, H309E, C329S RING finger mutants)

  • Test multiple E2 enzymes to determine specificity (UbcH5c was used in referenced studies)

Substrate Specificity:

  • Include unrelated proteins to confirm substrate selectivity

  • Use mutated versions of the substrate that might affect recognition

  • Compare ubiquitination patterns among related substrate family members

Detection Methods:

  • 32P-labeled ubiquitin provides high sensitivity for in vitro assays

  • Compare results using antibodies against ubiquitin versus substrate

  • Include proteasome inhibitors to accumulate ubiquitinated species in cellular assays

These controls ensure that observed ubiquitination is specifically mediated by Syvn1 and reflects physiologically relevant activity.

How can researchers optimize experimental conditions for studying Syvn1-mediated ER stress responses?

Optimizing experimental conditions for ER stress studies involving Syvn1 requires:

Stress Inducer Titration:

  • Establish dose-response curves for ER stress inducers (e.g., tunicamycin)

  • In referenced studies, 50 μg/mL tunicamycin induced moderate apoptosis (17.7 ± 3.8%) in control cells but severe apoptosis (66.3 ± 15.5%) in Syvn1 knockdown cells

  • Use multiple stress inducers to distinguish pathway-specific effects

Temporal Considerations:

  • Include time-course experiments to capture both early and late ER stress responses

  • Distinguish between adaptive and terminal UPR phases

  • Monitor dynamic changes in Syvn1 expression and activity during stress progression

Marker Selection:

  • Include markers for different UPR branches (PERK, IRE1, ATF6)

  • Monitor both upstream sensors (e.g., GRP78) and downstream effectors (e.g., CHOP)

  • Assess functional outcomes like cell viability, apoptosis (e.g., TUNEL assay) , and protein aggregation

These optimizations enable more precise characterization of Syvn1's role in modulating ER stress responses across different experimental conditions and disease models.

What are emerging therapeutic strategies targeting Syvn1 for disease treatment?

Several promising therapeutic approaches targeting Syvn1 are under investigation:

Small Molecule Inhibitors:

  • Development of specific inhibitors targeting Syvn1's ubiquitin ligase activity

  • Structure-based drug design focusing on the catalytic RING finger domain

  • Allosteric modulators affecting substrate recognition

Gene Therapy Approaches:

  • AAV-mediated delivery of SYVN1 shRNA has shown efficacy in preclinical models

  • Tissue-specific promoters to restrict Syvn1 modulation to affected tissues

  • CRISPR-based approaches for precision editing of SYVN1 expression

Combination Therapies:

  • Synergistic approaches combining Syvn1 inhibition with conventional treatments

  • For RA, combining Syvn1 targeting with anti-inflammatory agents

  • For neurodegenerative conditions, pairing with chaperone inducers to enhance protein folding

The key challenge remains achieving sufficient specificity to avoid disruption of essential ERAD functions while targeting disease-specific aspects of Syvn1 activity.

How might systematic interactome mapping advance our understanding of Syvn1 biology?

Comprehensive interactome mapping represents a frontier in Syvn1 research:

Multi-omics Integration:

  • Combining proteomics, transcriptomics, and metabolomics data

  • Correlating Syvn1 substrate profiles with disease-specific molecular signatures

  • Identifying context-dependent interaction networks

Tissue-Specific Interactomes:

  • Comparing Syvn1 interactors across different tissues and cell types

  • Identifying tissue-specific substrates that might explain organ-specific pathologies

  • Current evidence shows distinct roles in synovial tissue versus brain regions

Dynamic Interaction Mapping:

  • Capturing temporal changes in Syvn1 interactions during stress responses

  • Identifying condition-specific interactors under different pathological states

  • Understanding competitive binding between different substrates

Such approaches could reveal unexpected connections between Syvn1 and various cellular pathways, potentially identifying novel therapeutic targets.

What technological advances are needed to better understand Syvn1's role in protein quality control networks?

Several technological challenges remain in fully elucidating Syvn1's functions:

Single-Molecule Tracking:

  • Development of tools for visualizing individual Syvn1-substrate interactions

  • Super-resolution microscopy approaches to track ERAD components in real-time

  • Correlative light-electron microscopy to connect molecular events with ultrastructural changes

Organelle-Specific Analysis:

  • Improved methods for isolating intact ER subdomains

  • Tools for measuring local ubiquitination activity within specific ER regions

  • Current approaches have demonstrated differential effects of SYVN1 on intra-ER versus extra-ER GABA Aα1 levels

Systems Biology Models:

  • Computational frameworks integrating multiple quality control pathways

  • Mathematical modeling of ERAD flux and capacity under different conditions

  • Prediction of emergent properties from complex interaction networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.