Recombinant Mouse E3 ubiquitin-protein ligase TRIM13 (Trim13)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse E3 Ubiquitin-Protein Ligase TRIM13 (Trim13)

Recombinant Mouse E3 ubiquitin-protein ligase TRIM13, also known as Tripartite Motif-Containing 13, is an enzyme that functions as an E3 ubiquitin ligase . E3 ubiquitin ligases are essential components of the ubiquitin-proteasome system (UPS), which is responsible for selectively degrading cellular proteins . TRIM13 is involved in the retrotranslocation and turnover of membrane and secretory proteins from the endoplasmic reticulum (ER) . This process, known as ER-associated degradation (ERAD), targets misfolded proteins and regulates the degradation of correctly folded proteins .

Basic Information

CharacteristicDescription
NameE3 ubiquitin-protein ligase TRIM13
SynonymsRFP2, Ret Finger Protein 2, Tripartite motif-containing protein 13
OrganismMus musculus (Mouse)
UniProtKB No.Q9CYB0
Molecular WeightApproximately 46987.08 Da (Human)
Chromosome LocationChromosome 13 (Human)
EC Number6.3.2.-
Amino Acid SequenceMELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGLLEGNVRNSLWRPSPFKCPTCRKETSATGVNSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCVTDMQLICGICATRGEHTKHVFSSIEDAYAREKNAFESLFQSFETWRRGDALSRLDTLETNKRKALQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQTYDPEINKINTILQEQRMAFNIAEAFKDVSEPIIFLQQMQEFREKIKVIKETPLPHSNLPTSPLMKNFDTSQWGDIKLVDVDKLSLPQDTGVFTSKIPWYPYLLLMMVVLLGLLIFFGPTVFLEWSPLDELATWKDYLSSFNSYLTKSADFIEQSVFYWEQMTDGFFIFGERVKNVSLVALNNVAEFICKYKLL
Storage BufferTris-based buffer with 50% glycerol

Function

TRIM13 is anchored to the endoplasmic reticulum (ER) membrane and functions as an E3 ligase involved in the degradation of misfolded or selected proteins in the ER . It enhances ionizing radiation-induced p53 stability and apoptosis through the ubiquitination of MDM2 and AKT1, and it reduces AKT1 kinase activity by promoting MDM2 and AKT1 proteasomal degradation . TRIM13 regulates ER stress-induced autophagy and may act as a tumor suppressor . It also stimulates NF-kappa-B activity in the TLR2 signaling pathway and ubiquitinates TRAF6 via 'Lys-29'-linked polyubiquitination, which leads to NF-kappa-B activation . Additionally, TRIM13 participates in T-cell receptor-mediated NF-kappa-B activation and modulates the IKK complex by regulating IKBKG/NEMO ubiquitination in the presence of TNF, which represses NF-kappa-B .

Role in Cancer

TRIM13 has been identified as a tumor suppressor gene in lung cancer (LC), with its overexpression suppressing LC progression in vitro and in vivo . TRIM13 is located on chromosome 13 (13q14), a region frequently deleted in various malignancies . Studies have shown that TRIM13 is downregulated in esophageal, ovarian, and breast cancers, as well as leukemia . Lower TRIM13 expression levels in breast cancer patients are associated with poorer distant metastasis and recurrence-free survival, suggesting its potential as a prognostic marker . Additionally, downregulation of TRIM13 in multiple myeloma reduces cell cycle progression and tumor cell proliferation by inhibiting NF-kappa-B pathway activity and the 20S proteasome .

4.1. TRIM13 Interacts with RPS27A

TRIM13 interacts with RPS27A (ribosomal protein S27A) and enhances its ubiquitination and degradation, leading to reduced RPS27A expression .

Involvement in Immune Response

TRIM13 is involved in the innate immune response by interacting with STING (Stimulator of Interferon Genes) and modulating the inflammatory cytokine production . TRIM13 deficiency enhances pathogenic-DNA-triggered inflammatory cytokine production, inhibits DNA virus replication, and causes age-related autoinflammation .

5.1. TRIM13 and STING Interaction

TRIM13 interacts with STING via their transmembrane domains . TRIM13 deficiency can lead to increased levels of inflammatory cytokines and immune cell infiltration in various tissues .

Domains

TRIM13 contains three conserved domains in its N-terminus: a RING (R) domain, a B-Box (B) domain, and a coiled-coil (CC) domain, as well as a transmembrane (TM) domain in its C-terminus . The coiled-coil domain is required for the induction of autophagy during endoplasmic reticulum (ER) stress .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
Trim13; Rfp2; E3 ubiquitin-protein ligase TRIM13; Putative tumor suppressor RFP2; RING-type E3 ubiquitin transferase TRIM13; Ret finger protein 2; Tripartite motif-containing protein 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-407
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Trim13
Target Protein Sequence
MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGLLEGNVRNSLWRPSPFKCPTCRKE TSATGVNSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCVTDMQLICGICATR GEHTKHVFSSIEDAYAREKNAFESLFQSFETWRRGDALSRLDTLETNKRKALQLLTKDSD KVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQTYDPEINKINTILQEQRMAFNIAEAFK DVSEPIIFLQQMQEFREKIKVIKETPLPHSNLPTSPLMKNFDTSQWGDIKLVDVDKLSLP QDTGVFTSKIPWYPYLLLMMVVLLGLLIFFGPTVFLEWSPLDELATWKDYLSSFNSYLTK SADFIEQSVFYWEQMTDGFFIFGERVKNVSLVALNNVAEFICKYKLL
Uniprot No.

Target Background

Function
TRIM13 is an endoplasmic reticulum (ER) membrane-anchored E3 ubiquitin ligase involved in the ER-associated degradation (ERAD) pathway. ERAD mediates the retrotranslocation and turnover of membrane and secretory proteins, encompassing both misfolded and correctly folded proteins. TRIM13 enhances ionizing radiation-induced p53/TP53 stability and apoptosis by ubiquitinating MDM2 and AKT1, subsequently reducing AKT1 kinase activity through MDM2 and AKT1 proteasomal degradation. It also regulates ER stress-induced autophagy and may function as a tumor suppressor. Furthermore, TRIM13 plays a role in innate immunity by stimulating NF-κB activity in the TLR2 signaling pathway, ubiquitinates TRAF6 (leading to NF-κB activation via Lys-29-linked polyubiquitination), and participates in T-cell receptor-mediated NF-κB activation. In the presence of TNF, TRIM13 modulates the IKK complex by regulating IKBKG/NEMO ubiquitination, thereby repressing NF-κB.
Gene References Into Functions
  1. TRIM13 interacts with MDA5 and negatively regulates MDA5-mediated type I IFN production. PMID: 25008915
Database Links
Protein Families
TRIM/RBCC family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the basic domain architecture of TRIM13?

TRIM13 belongs to the TRIM/RBCC protein family characterized by a tripartite motif consisting of a RING finger domain, one or two B-box domains, and a coiled-coil region. The RING domain at the N-terminus confers E3 ubiquitin ligase activity, which is essential for TRIM13's function in catalyzing the addition of ubiquitin to target proteins. The B-box and coiled-coil domains primarily mediate protein-protein interactions, as demonstrated by interaction studies with CCNA1 where these domains were found to be predominantly responsible for this association . TRIM13 also contains a C-terminal transmembrane domain that anchors it to the ER membrane, distinguishing it from many other TRIM family proteins. This unique architecture allows TRIM13 to function at the interface of the ER and other cellular compartments, particularly in coordinating the retrotranslocation and turnover of membrane and secretory proteins through ER-associated degradation (ERAD) pathways .

How does TRIM13 function as an E3 ubiquitin ligase?

TRIM13 functions as a RING-type E3 ubiquitin ligase that catalyzes the transfer of ubiquitin from an E2 conjugating enzyme to specific substrate proteins. In biochemical studies, TRIM13 has demonstrated versatility in utilizing multiple E2 conjugating enzymes for substrate ubiquitination, with the notable exception of UbcH5a . This E3 ligase can build various types of ubiquitin linkages on its substrates, including K6, K27, K29, K48, and K63, but shows reduced activity for K11 and K33 linkages . The functional significance of these different ubiquitin chain topologies is context-dependent - while K48-linked chains typically signal for proteasomal degradation, other linkage types (particularly K27-linked) have been associated with protein stabilization and signaling pathway modulation. This versatility in chain formation allows TRIM13 to influence diverse cellular processes including protein quality control, cell cycle regulation, and immune signaling. For example, TRIM13 has been found to stabilize cell cycle proteins like CCNA1 through non-canonical ubiquitination rather than marking them for degradation .

What is the cellular localization of TRIM13 and how does it influence function?

While TRIM13 has traditionally been described as an ER membrane-anchored protein due to its C-terminal transmembrane domain, recent research in hematopoietic cells reveals a more complex localization pattern. In acute myeloid leukemia (AML) cell lines (U937, HL60, and THP1), TRIM13 shows predominant nuclear localization, with only a minority of cells displaying the previously described perinuclear/ER staining pattern . This nuclear localization appears to be a feature of immature hematopoietic cells, as it was also observed in patient-derived xenograft models and healthy mobilized CD34+ peripheral blood stem cells. The functional significance of this localization was demonstrated through experiments with nuclear export signal-tagged TRIM13, which revealed that nuclear, rather than cytoplasmic, localization is responsible for TRIM13's repressive phenotype in AML . Furthermore, TRIM13 shows cell cycle-dependent localization patterns, with staining intensity increasing as cells progress through the cell cycle, suggesting temporal regulation of its activity. This dual localization capability allows TRIM13 to perform distinct functions in different cellular compartments - regulating ERAD processes at the ER membrane while potentially influencing transcription or chromatin dynamics in the nucleus.

What are optimal methods for studying TRIM13's E3 ligase activity?

When investigating TRIM13's E3 ligase activity, researchers should employ a multi-tiered experimental approach combining both cellular and cell-free systems. In cell-free ubiquitination assays, purified recombinant TRIM13 can be incubated with potential substrates (such as CCNA1) along with E1 and various E2 enzymes to directly assess ubiquitination activity . These assays should include a panel of different E2 enzymes, as TRIM13 has demonstrated compatibility with multiple E2s, allowing for the identification of preferred E2 partners for specific substrates. To detect different ubiquitin chain topologies, researchers can utilize ubiquitin mutants where only a single lysine residue remains available for chain formation (e.g., K6-only, K27-only, K48-only ubiquitin), which enables precise determination of linkage specificity. For cellular studies, co-immunoprecipitation experiments following co-expression of epitope-tagged TRIM13 and potential substrates can identify physical interactions and ubiquitination patterns . These experiments should be complemented with stability assays using cycloheximide chase to determine whether TRIM13-mediated ubiquitination leads to degradation or stabilization of target proteins. Domain deletion mutants of TRIM13, particularly those lacking the RING domain, serve as excellent negative controls for distinguishing between catalytic and scaffolding functions.

How can TRIM13 knockout or knockdown models be effectively generated and validated?

Generating reliable TRIM13 knockout or knockdown models requires careful consideration of both approach and validation strategies. For CRISPR-Cas9 gene editing, targeting the RING domain offers particular advantages as it generates catalytically inactive but structurally intact TRIM13, providing insight into the specific contribution of ubiquitin ligase activity . When designing guide RNAs, researchers should target regions that will create in-frame deletions of functional domains rather than introducing frameshift mutations that might trigger nonsense-mediated decay of the entire transcript. For validation of editing efficiency, researchers should perform both genomic PCR to confirm the deletion and immunoblotting to verify the expression of truncated protein products. In cases where complete TRIM13 knockout is desired, RNA interference approaches using short hairpin RNAs (shRNAs) have proven effective in studying TRIM13 function in primary AML samples, with knockdown efficiencies verifiable by quantitative PCR and western blotting . When developing these models, researchers should be aware of potential compensatory upregulation of other TRIM family members, which can be monitored by targeted gene expression analysis. Functional validation should include assessment of phenotypic changes consistent with TRIM13's known roles, such as altered cell cycle progression, colony formation capacity, or pathway-specific reporter assays.

What are the considerations for choosing appropriate TRIM13 antibodies for different applications?

Selecting appropriate antibodies for TRIM13 detection requires careful consideration of the intended application and the specific epitopes targeted. For western blotting applications, antibodies directed against N-terminal domains of TRIM13 are preferable when studying RING domain deletion mutants, as they will detect both wild-type and mutant forms . Researchers should validate antibody specificity using TRIM13 knockout or knockdown controls to prevent misinterpretation of non-specific signals. For immunohistochemistry or immunofluorescence studies, antibodies recognizing epitopes between amino acids 1-350 of human TRIM13 have demonstrated good performance in detecting both nuclear and ER-localized protein . When studying potential post-translational modifications of TRIM13, phospho-specific or ubiquitin-specific antibodies may be required. For co-immunoprecipitation experiments, researchers should carefully select antibodies that do not interfere with protein-protein interaction interfaces, particularly avoiding those targeting the B-box and coiled-coil domains when studying TRIM13-substrate interactions. One important consideration is cross-reactivity between mouse and human TRIM13, which share significant sequence homology; validation experiments using species-specific positive and negative controls are essential when working with models from different species.

How does TRIM13 regulate the STING pathway in innate immunity?

TRIM13 plays a crucial regulatory role in the STING (stimulator of interferon genes) pathway, which is central to innate immune responses against pathogenic DNAs. TRIM13 interacts directly with STING via its transmembrane domain, and this interaction occurs prominently at the resting state but becomes attenuated following viral infection, such as with HSV-1 . Mechanistically, TRIM13 catalyzes K6-linked polyubiquitination of STING, which has a dual effect on STING activity: it decelerates the exit of STING from the endoplasmic reticulum and simultaneously accelerates ER-initiated degradation of STING . This ubiquitination-dependent regulation serves as a checkpoint to prevent excessive STING activation, which could otherwise lead to hyperinflammatory responses. The physiological importance of this regulation is evidenced by findings in TRIM13-deficient models, which display enhanced production of inflammatory cytokines in response to pathogenic DNA, more effective inhibition of DNA virus replication, and development of age-related autoinflammation . Importantly, STING deficiency reverses the enhanced anti-DNA virus response observed in TRIM13 knockout mice, confirming the specificity of this regulatory relationship.

What are the experimental models for studying TRIM13's role in inflammatory disease?

Several experimental models have proven valuable for investigating TRIM13's function in inflammatory disease contexts. TRIM13 knockout mice represent a primary in vivo model for studying the consequences of TRIM13 deficiency on inflammatory responses. These mice display age-related autoinflammation and enhanced pathogenic-DNA-triggered inflammatory cytokine production, making them particularly useful for studying chronic inflammatory conditions . For acute infection studies, challenging these knockout mice with DNA viruses such as HSV-1 allows assessment of TRIM13's role in balancing effective pathogen clearance against excessive inflammatory damage. At the cellular level, bone marrow-derived macrophages (BMDMs) from wild-type and TRIM13-deficient mice provide a tractable system for studying innate immune signaling, as these cells express both TRIM13 and STING and are responsive to pathogenic DNA stimuli . For mechanistic studies of TRIM13-STING interactions, reconstitution experiments in STING-deficient cell lines (such as modified RAW264.7 cells) expressing TRIM13 variants can help dissect domain-specific functions . Human cell culture models using THP-1 monocytes or primary peripheral blood mononuclear cells with TRIM13 knockdown or overexpression also provide translational relevance for inflammatory disease research, allowing assessment of cytokine production, NF-κB activation, and other inflammatory readouts.

How does TRIM13 intersect with other innate immune signaling pathways?

TRIM13's regulatory role extends beyond the STING pathway to include multiple innate immune signaling networks. In the TLR2 signaling pathway, TRIM13 stimulates NF-κB activity through ubiquitination of TRAF6 via 'Lys-29'-linked polyubiquitination chains . This contrasts with its function in TNF signaling, where TRIM13 modulates the IKK complex by regulating IKBKG/NEMO ubiquitination, which leads to the repression rather than activation of NF-κB . TRIM13 also participates in T-cell receptor-mediated NF-κB activation, indicating its involvement in adaptive immune regulation . These diverse and sometimes opposing functions suggest that TRIM13 acts as a contextual regulator of inflammatory signaling, with its effects determined by the specific stimuli, cell type, and timing of activation. When designing experiments to dissect these roles, researchers should consider employing stimulus-specific pathway inhibitors alongside TRIM13 manipulation to isolate its contribution to particular signaling cascades. The temporal dynamics of TRIM13's interactions with pathway components should also be assessed through time-course experiments, as the protein's interaction with STING, for example, changes significantly following viral infection . Quantitative assessment of these pathway intersections can be achieved through phospho-specific immunoblotting, reporter assays for transcription factor activation, and cytokine profiling.

What evidence supports TRIM13's role as a tumor suppressor?

Substantial evidence supports TRIM13's function as a tumor suppressor, particularly in hematological malignancies such as acute myeloid leukemia (AML). Analysis of patient data from the Cancer Genome Atlas reveals that high TRIM13 expression correlates with good prognosis in AML, whereas low expression is associated with poor outcomes . This clinical correlation is mechanistically supported by experimental evidence showing that overexpression of TRIM13 in multiple AML cell lines (U937, MOLM13) significantly reduces their leukemogenic potential, as demonstrated by decreased colony-forming capacity, increased apoptosis, and induction of differentiation markers such as CD14 . In xenograft models, TRIM13 overexpression results in reduced bone marrow engraftment of leukemic cells and extended survival of recipient mice . Conversely, knockdown of TRIM13 in pediatric AML patient-derived xenografts drives enhanced expansion of leukemic cells within the bone marrow and contributes to more aggressive disease progression . At the molecular level, TRIM13's tumor suppressor function appears to be mediated through its E3 ligase activity, as evidenced by experiments with RING domain deletion mutants that show increased colony formation capacity and reduced cell death compared to wild-type controls . The cell cycle regulatory function of TRIM13 through stabilization of proteins like CCNA1 further supports its role in preventing uncontrolled proliferation characteristic of cancer cells.

How does TRIM13 influence cell cycle regulation in cancer cells?

TRIM13 exerts significant influence on cell cycle regulation in cancer cells through its E3 ligase activity, primarily by stabilizing key cell cycle regulatory proteins. Ubiquitome analysis of cells with wild-type TRIM13 versus RING domain deletion mutants reveals a strong enrichment of ubiquitinated cell cycle-associated proteins, including cyclins (CCNA1, CCNB1) and cyclin-dependent kinases (CDK1) . Rather than targeting these proteins for degradation, TRIM13-mediated ubiquitination appears to stabilize them, as evidenced by reduced protein levels (despite unchanged mRNA expression) in TRIM13 RING domain deletion mutants . This stabilization function is particularly evident for CCNA1, which shows increased colocalization with TRIM13 in a cell cycle stage-dependent manner and demonstrates accelerated turnover in cells lacking functional TRIM13 . Functionally, the importance of this regulation is demonstrated by the ability of CCNA1 re-expression to reverse the increased clonogenic capacity observed in TRIM13 RING domain deletion mutants . TRIM13's nuclear localization in cancer cells appears critical for this cell cycle regulatory function, as cytoplasmic redirection of TRIM13 through addition of a nuclear export signal abolishes its anti-leukemic effects . The cell cycle impact of TRIM13 is further evidenced by the observation that TRIM13 staining intensity increases with progression through the cell cycle, suggesting dynamic regulation of its activity during different phases.

What methodologies are optimal for investigating TRIM13-dependent tumor suppression mechanisms?

Investigating TRIM13-dependent tumor suppression mechanisms requires a comprehensive experimental approach spanning molecular, cellular, and in vivo techniques. For molecular mechanism studies, researchers should employ ubiquitination assays using both cell-based and in vitro reconstitution systems to identify which substrates are differentially modified by TRIM13 and what specific ubiquitin chain topologies are involved . Mass spectrometry-based ubiquitome analysis comparing wild-type and catalytically inactive TRIM13 (RING domain deletion) provides a powerful unbiased approach to identifying the full spectrum of TRIM13 substrates relevant to tumor suppression . At the cellular level, clonogenic assays, cell cycle analysis, and differentiation marker assessment provide functional readouts of TRIM13's impact on cancer cell phenotypes . These should be complemented with rescue experiments where putative TRIM13 substrates (such as CCNA1) are re-expressed in TRIM13-deficient backgrounds to confirm their role in mediating observed phenotypes . For in vivo validation, patient-derived xenograft models with TRIM13 knockdown or overexpression offer valuable platforms for assessing leukemogenic potential and response to treatment . To establish clinical relevance, correlative analysis of TRIM13 expression in patient samples, particularly in relation to disease progression and treatment response, should be performed. A particularly powerful approach combines chromatin immunoprecipitation sequencing (ChIP-seq) with TRIM13 localization studies to understand how nuclear TRIM13 might influence transcriptional programs relevant to cancer progression.

How can researchers investigate the dual ER and nuclear functions of TRIM13?

Investigating TRIM13's dual localization and function at the ER membrane and in the nucleus requires sophisticated experimental approaches that can distinguish compartment-specific activities. To study ER-associated functions, researchers can employ subcellular fractionation techniques followed by immunoblotting to quantify the distribution of TRIM13 between membrane and soluble fractions . For visualizing TRIM13's ER localization, super-resolution microscopy with co-staining for ER markers provides spatial context for TRIM13's transmembrane domain-dependent positioning. To specifically manipulate TRIM13's subcellular distribution, researchers can generate chimeric constructs by replacing TRIM13's C-terminal transmembrane domain with alternative targeting sequences, such as nuclear export signals or nuclear localization signals . These localization-altered variants can then be expressed in TRIM13-deficient backgrounds to assess which phenotypes depend on nuclear versus ER localization. For nuclear function studies, chromatin immunoprecipitation (ChIP) assays can identify potential genomic binding sites of TRIM13, while proximity-dependent biotinylation (BioID) approaches with nuclear-targeted TRIM13 can reveal the nuclear interactome. Time-lapse imaging of fluorescently-tagged TRIM13 in synchronized cells provides insight into dynamic changes in localization during cell cycle progression, correlating with the observation that TRIM13 staining intensity increases as cells progress through the cell cycle .

What are the implications of TRIM13's non-canonical ubiquitination on protein stability?

TRIM13's ability to catalyze non-canonical ubiquitination has significant implications for protein stability regulation that diverge from the conventional ubiquitin-proteasome degradation pathway. While K48-linked ubiquitin chains typically target proteins for proteasomal degradation, TRIM13 can generate alternative linkage types including K6, K27, and K29 that have been associated with protein stabilization and signaling . This is exemplified by TRIM13's relationship with CCNA1, where TRIM13-mediated ubiquitination appears to protect CCNA1 from degradation rather than promoting it . To investigate this phenomenon, researchers should employ linkage-specific ubiquitin antibodies or mass spectrometry techniques that can distinguish between different ubiquitin chain topologies on target proteins. Stability assays using cycloheximide chase experiments comparing wild-type cells with TRIM13 knockout or RING domain mutants can quantify the impact of TRIM13 activity on protein half-life. For mechanistic understanding, researchers should investigate whether TRIM13-mediated ubiquitination shields recognition sites for other E3 ligases that might otherwise target the protein for degradation, or whether these modifications create binding interfaces for stabilizing cofactors. Proteasome inhibition experiments can determine whether observed stabilization effects are dependent on or independent of proteasome function. Additionally, identification of specific deubiquitinating enzymes that counteract TRIM13-mediated modifications would provide insight into the dynamic regulation of these non-canonical ubiquitination events and their impact on protein homeostasis.

How might TRIM13 be targeted therapeutically in inflammatory or malignant diseases?

Therapeutic targeting of TRIM13 presents different strategies depending on the disease context, with potentially opposite approaches required for inflammatory versus malignant conditions. In inflammatory diseases associated with aberrant STING activation, enhancing TRIM13 activity could help restrain excessive inflammatory responses . This might be achieved through small molecule stabilizers of TRIM13 protein or compounds that enhance its E3 ligase activity toward STING. Conversely, in hematological malignancies where TRIM13 functions as a tumor suppressor, strategies to increase TRIM13 expression or activity could have therapeutic benefits . This could involve epigenetic modulators targeting the repression of TRIM13 by chromatin assembly factors like CHAF1B, which has been identified as a negative regulator of TRIM13 expression in AML . Alternatively, gene therapy approaches delivering functional TRIM13 to cancer cells could restore its tumor-suppressive effects. For structure-based drug design, researchers should focus on compounds that modulate protein-protein interactions between TRIM13 and its key substrates rather than broadly affecting its catalytic activity, as this would provide greater specificity. High-throughput screening assays measuring ubiquitination of specific TRIM13 substrates (such as STING for inflammatory diseases or CCNA1 for cancer) could identify candidate compounds for therapeutic development. Given TRIM13's multiple cellular functions, researchers must carefully assess the potential off-target effects of TRIM13-directed therapies through comprehensive pathway analysis and phenotypic screening in relevant cell types.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.