Recombinant Mouse Ectonucleoside triphosphate diphosphohydrolase 4 (Entpd4)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Ectonucleoside Triphosphate Diphosphohydrolase 4 (Entpd4)

Ectonucleoside triphosphate diphosphohydrolase 4 (ENTPD4) is an enzyme that, in mice, is encoded by the Entpd4 gene . ENTPD4 functions by catalyzing the hydrolysis of nucleoside triphosphates and diphosphates, and it requires either calcium or magnesium for this process . It shows a preference for pyrimidines . It is predicted to participate in the metabolic processes of nucleobase-containing small molecules and to be located in the Golgi membrane and autophagosome membrane .

Gene Information

The Gene ID for ENTPD4 is 9583 .

Interactions Affecting ENTPD4 Expression

Various compounds and conditions can affect the expression of ENTPD4. Some examples include:

  • beta-lapachone Increases expression of ENTPD4 mRNA

  • bis(2-ethylhexyl) phthalate Decreases expression of ENTPD4 protein

  • bisphenol A Decreases expression of ENTPD4 mRNA

  • Bupivacaine, Tetrodotoxin, and Dexamethasone (co-treatment) Decreases expression of ENTPD4 mRNA

  • Cadmium Chloride Increases expression of ENTPD4 mRNA

  • Carbon Tetrachloride Decreases expression of ENTPD4 mRNA

  • Doxorubicin Decreases expression of ENTPD4 mRNA

  • Fenthion Decreases expression of ENTPD4 mRNA

  • Fenvalerate Increases expression of ENTPD4 mRNA

  • 1 and 2-Dimethylhydrazine co-treated with Folic Acid Increases expression of ENTPD4 mRNA

  • Sunitinib Increases expression of ENTPD4 mRNA

  • Valproic Acid Affects the expression of ENTPD4 mRNA, generally decreasing it

  • Vinclozolin Decreases expression of ENTPD4 mRNA

  • Yessotoxin analog Increases expression of ENTPD4 mRNA

Recombinant Mouse ENTPD1

Recombinant Mouse Ectonucleoside Triphosphate Diphosphohydrolase 1 (ENTPD1) is a purified prokaryotic protein with a purity of >90% by SDS-PAGE . It is expressed in E. coli and has an endotoxin level of <1.0 EU per 1ug . The protein includes an N-terminal His Tag and has a theoretical molecular weight of 32kDa .

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process. If you require a specific tag, please inform us; we will prioritize fulfilling your request.
Synonyms
Entpd4; Lalp70; Lysal1; Ectonucleoside triphosphate diphosphohydrolase 4; NTPDase 4; Lysosomal apyrase-like protein of 70 kDa; Uridine-diphosphatase; UDPase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-613
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Entpd4
Target Protein Sequence
MGRIGISCLFPASWHFSISPVGCPRILNTNLRQIVVISILAAAVSLLYFSVVIIRSKYGW LSKDKKFQRYLARVTDVEATDTNNPSVNYGIVVDCGSSGSRIFVYCWPRHNGNPHDLLDI RQMRDKNRKPVVMKIKPGISEFATSPEKVSDYISPLLSFAAEHVPRAKHKETPLYILCTA GMRVLPESQQKAILEDLLTDIPVHYDFLFSDSHAEVISGKQEGVYAWIGINFVLGRFEHI EEDDEAVVEVNIPGSESSEAIVRKRTAGVLDMGGVSTQIAYEVPQTVSFASSQQEEVAKN LLAEFNLGCDVHQTEHVYRVYVATFLGFGGNAARQRYEDRLFASTVQKNRLLGKQTGLTP DAPLLDPCLPLDIKDEIQQNGQTLYLQGTGDFDLCRETLQPFMNKTNETQTSLNGVYQPP IHFQNSEFYGFSEFYYCTEDVLRMGGDYNAARFTQAAKDYCATKWSILRERFDRGLYASH ADLHRLKYQCFKSAWMFEVFHKGFSFPVTYKNLKTALQVYDKEVQWTLGAILYRTRFLPL RDIRQEVFRAGHAHWRGVSFVYNHYLFSGCFLVVLLSILLYLLRLRRIHRRAPRTGSLWM EEGLPSQKGPGPL
Uniprot No.

Target Background

Function
Recombinant Mouse Ectonucleoside triphosphate diphosphohydrolase 4 (ENTPD4) catalyzes the hydrolysis of nucleoside triphosphates and diphosphates in a calcium- or magnesium-dependent manner, exhibiting a preference for pyrimidines. It preferentially hydrolyzes UTP and TTP. AMP, ADP, ATP, and UMP are not substrates. Ca²⁺ activates ENTPD4 more effectively than Mg²⁺. ENTPD4 demonstrates broad substrate specificity, hydrolyzing all nucleotide di- and triphosphates except ADP and ATP. It preferentially hydrolyzes CTP, UDP, CDP, GTP, and GDP and utilizes Ca²⁺ or Mg²⁺ equally.
Database Links
Protein Families
GDA1/CD39 NTPase family
Subcellular Location
[Isoform 1]: Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.; [Isoform 2]: Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous.

Q&A

What is the functional relationship between ENTPD4 and other members of the NTPDase family?

ENTPD4 belongs to the E-NTPDase family of ectonucleotidases, which are enzymes that hydrolyze extracellular nucleotides to their respective nucleosides. Unlike the well-characterized NTPDase1 (CD39), which hydrolyzes both beta and gamma phosphate residues with a preference for ATP, ENTPD4 has distinct substrate preferences and cellular localization patterns .

While NTPDase1 is primarily found on the surface of various immune cells (B lymphocytes, natural killer cells, T cells) and some endothelial cells as an integral membrane protein with an extracellular active site, ENTPD4 demonstrates different tissue distribution and subcellular localization . The NTPDase family was originally named with confusing nomenclature (CD39L1, CD39L2, etc.), but scientists at the Second International Workshop on Ecto-ATPases proposed a more systematic naming convention where each member is termed as NTPDase proteins and classified in order of discovery and characterization .

The functional differences between these family members manifest in their:

  • Substrate specificity (ATP vs. other nucleotides)

  • Cellular and tissue expression patterns

  • Subcellular localization

  • Roles in physiological and pathological processes

Understanding these differences is crucial when designing experiments that specifically target ENTPD4 rather than other NTPDase family members.

What are the recommended experimental conditions for measuring recombinant mouse ENTPD4 enzyme activity?

When measuring recombinant mouse ENTPD4 enzyme activity, researchers should adapt protocols similar to those used for other NTPDase family members, with specific modifications for optimal ENTPD4 activity. Based on protocols for related enzymes, the following conditions are recommended:

Enzyme Activity Assay Protocol:

  • Prepare reaction buffer appropriate for ENTPD4 (typically phosphate-free buffer at pH 7.4)

  • Prepare substrate solution (nucleotide at 50-100 μM concentration)

  • Add recombinant ENTPD4 protein (concentration determined by preliminary titration experiments)

  • Incubate at 37°C for 30 minutes (optimize time based on preliminary experiments)

  • Detect released phosphate using Malachite Green assay:

    • Add 10 μL Malachite Green Reagent A

    • Incubate for 10 minutes at room temperature

    • Add 10 μL Malachite Green Reagent B

    • Incubate for 20 minutes at room temperature

    • Read absorbance at 620 nm in endpoint mode

Activity Calculation:

Calculate specific activity using the following formula:

Specific Activity (pmol/min/μg) =Phosphate released (nmol) × (1000 pmol/nmol)
Incubation time (min) × amount of enzyme (μg)

Note: Phosphate release should be derived from a standard curve and adjusted for substrate blank .

Temperature, pH, and buffer composition should be optimized specifically for ENTPD4 through systematic testing, as these parameters can significantly impact enzyme activity.

How should I design qPCR primers specific to mouse ENTPD4 to avoid cross-reactivity with other NTPDase family members?

Designing specific qPCR primers for mouse ENTPD4 requires careful consideration of sequence homology with other NTPDase family members. Follow these methodological steps:

  • Sequence Analysis: Obtain complete mRNA sequences for mouse ENTPD4 and other NTPDase family members from databases like Ensembl or NCBI.

  • Identify Unique Regions: Use sequence alignment tools like Clustal to identify regions unique to ENTPD4 that show minimal homology with other family members .

  • Design Parameters:

    • Target exon junctions when possible to avoid genomic DNA amplification

    • Ensure primers span at least one intron

    • Consider all transcript variants of ENTPD4

    • Aim for amplicon size of 70-150 bp for optimal qPCR efficiency

    • Design primers with Tm of 58-62°C with minimal difference between forward and reverse primers

  • SNP Avoidance: Check primer regions against SNP databases to avoid polymorphic regions that could affect primer binding .

  • Specificity Verification: Use BLAST to confirm specificity of your designed primers against the entire mouse genome .

  • In silico Testing: Prior to ordering primers, simulate PCR results using in silico PCR tools to predict potential cross-reactivity.

  • Experimental Validation: After obtaining primers, validate specificity by:

    • Running qPCR on known positive (tissues with high ENTPD4 expression) and negative controls

    • Confirming single product by melt curve analysis

    • Sequencing the amplicon to verify identity

This comprehensive approach will help ensure your qPCR assay specifically measures ENTPD4 without interference from other NTPDase family members.

What controls are essential when performing functional assays with recombinant mouse ENTPD4?

When performing functional assays with recombinant mouse ENTPD4, incorporating appropriate controls is crucial for result validity and interpretability. Essential controls include:

Negative Controls:

  • Buffer-only control (no enzyme, no substrate) to establish baseline signal

  • Enzyme-free control (substrate only) to detect spontaneous substrate hydrolysis

  • Heat-inactivated ENTPD4 to confirm activity is enzymatic rather than chemical

  • Specific inhibitor control if available for ENTPD4

Positive Controls:

  • Well-characterized recombinant NTPDase (e.g., NTPDase1/CD39) with known activity

  • Commercial enzyme standard with similar activity (e.g., potato apyrase)

Specificity Controls:

  • Non-specific protein at equivalent concentration to control for protein-mediated effects

  • Substrate analogs resistant to hydrolysis to confirm substrate specificity

Technical Validation Controls:

  • Standard curve using relevant product (e.g., inorganic phosphate for phosphohydrolase assays)

  • Internal reference standards for normalization between experiments

  • Biological and technical replicates to assess reproducibility

These controls help identify and minimize technical artifacts, substrate degradation issues, and non-specific effects that could confound interpretation of ENTPD4 activity data. As Bizouarn notes, "Running sufficient replicates to get statistically correct information verifies an observed change in expression levels" .

How can I optimize the purification of recombinant mouse ENTPD4 to maintain enzymatic activity?

Purification of recombinant mouse ENTPD4 with preserved enzymatic activity requires careful consideration of protein structure and stability factors. The following methodological approach is recommended:

  • Expression System Selection:

    • Choose mammalian expression systems (e.g., HEK293, CHO cells) for proper post-translational modifications

    • Consider using a secretion signal to obtain soluble ectodomain, similar to approaches used for NTPDase1

    • Include appropriate affinity tags (His, FLAG, etc.) that don't interfere with enzyme activity

  • Buffer Optimization:

    • Use buffers containing divalent cations (Ca²⁺, Mg²⁺) which are typically required for NTPDase activity

    • Maintain neutral to slightly alkaline pH (7.0-8.0)

    • Include glycerol (10-20%) to enhance protein stability

    • Consider adding reducing agents (e.g., DTT, β-mercaptoethanol) at low concentrations

  • Purification Strategy:

    • Employ gentle affinity chromatography as the primary purification step

    • Minimize exposure to extreme conditions (pH, temperature, salt)

    • Use size exclusion chromatography to remove aggregates and obtain homogeneous protein

    • Perform all purification steps at 4°C to preserve activity

  • Activity Preservation:

    • Add stabilizing agents (glycerol, specific substrates at low concentration)

    • Avoid freeze-thaw cycles; aliquot and flash-freeze in liquid nitrogen

    • Store with protease inhibitors to prevent degradation

  • Quality Assessment:

    • Verify homogeneity by SDS-PAGE and size exclusion chromatography

    • Confirm identity by mass spectrometry or Western blot

    • Measure specific activity after each purification step to monitor activity preservation

    • Assess thermal stability to determine optimal storage conditions

For reconstitution after lyophilization, rehydrate the protein carefully in buffer containing stabilizing agents and allow sufficient time for proper refolding before activity measurements .

What parameters should be considered when designing experiments to study ENTPD4 expression in different mouse tissues?

Designing robust experiments to study ENTPD4 expression across mouse tissues requires careful planning to account for various sources of biological and technical variability. Key parameters to consider include:

Biological Parameters:

Technical Parameters:

  • Sample collection and preservation:

    • Harvest tissues with minimal ischemia time

    • Use consistent protocols for tissue extraction and preservation

    • Consider flash-freezing in liquid nitrogen for RNA/protein preservation

  • RNA quality assessment:

    • Verify RNA integrity (RIN > 8) before proceeding to expression analysis

    • Check for genomic DNA contamination

  • Primer design and validation:

    • Ensure primers are specific to ENTPD4 and not other NTPDase family members

    • Validate primer efficiency (90-110%) using standard curves

  • Reference gene selection:

    • Test multiple reference genes for stability across all tissues studied

    • Use at least 3 reference genes for normalization of expression data

  • Statistical considerations:

    • Determine appropriate sample size through power analysis

    • Include sufficient biological replicates (minimum n=3, preferably n≥5)

    • Plan for technical replicates (typically triplicates)

As noted by Bishop, "complete removal of RNA from cDNA samples is essential for obtaining accurate cDNA content used for data normalization" . Additionally, consider using digital PCR for absolute quantification when comparing expression across diverse tissues where reference gene stability may vary.

What statistical approaches are most appropriate for analyzing ENTPD4 enzyme activity data?

Analyzing ENTPD4 enzyme activity data requires thoughtful statistical approaches to account for the nature of enzymatic reactions and experimental design. The following methodological framework is recommended:

Preliminary Data Processing:

  • Outlier detection: Use Grubbs' test or Dixon's Q test to identify and potentially exclude outliers

  • Normality testing: Apply Shapiro-Wilk or Kolmogorov-Smirnov tests to determine if data follows normal distribution

  • Transformation: Consider log or square root transformations for non-normally distributed data

Statistical Tests for Different Experimental Designs:

Experimental DesignRecommended Statistical TestApplication
Two conditionsUnpaired t-test (normal) or Mann-Whitney U (non-normal)Comparing wild-type vs. knockout ENTPD4 activity
Multiple conditionsOne-way ANOVA with post-hoc tests (normal) or Kruskal-Wallis (non-normal)Comparing ENTPD4 activity across multiple tissues
Two factorsTwo-way ANOVA with interaction termExamining effects of treatment and genotype on ENTPD4 activity
Correlation analysisPearson (linear, normal) or Spearman (non-linear or non-normal)Correlating ENTPD4 activity with physiological parameters
Enzyme kineticsNon-linear regression (Michaelis-Menten, allosteric models)Determining Km, Vmax and other kinetic parameters

Advanced Considerations:

  • Sample size adequacy: Calculate observed power post-analysis; consider increasing sample size if power < 0.8

  • Multiple comparisons correction: Apply Bonferroni, Holm-Sidak, or false discovery rate methods when performing multiple comparisons

  • Reproducibility: Report both biological and technical variability separately

  • Visualization: Present enzyme activity data with individual data points, means, and error bars showing standard deviation or standard error

For kinetic studies of ENTPD4, apply specialized enzyme kinetics software to fit appropriate models (Michaelis-Menten, Hill equation, etc.) and derive parameters such as Km, Vmax, kcat, and substrate specificity constants. When comparing kinetic parameters between experimental conditions, use extra sum-of-squares F test to determine if differences are statistically significant.

How should I interpret variations in ENTPD4 expression across different experimental conditions?

Interpreting variations in ENTPD4 expression requires systematic analysis that accounts for both biological significance and technical factors. Follow this structured approach to ensure robust interpretation:

Step 1: Technical Validation
First, verify that observed variations represent true biological differences rather than technical artifacts:

  • Confirm consistent RNA/cDNA quality across samples (RNA integrity, A260/A280 ratios)

  • Verify qPCR efficiency and consistency (standard curves, Cq values for reference genes)

  • Check for outliers using graphical methods and statistical tests

  • Ensure proper normalization with validated reference genes

Step 2: Statistical Assessment
Determine if observed differences reach statistical significance:

  • Apply appropriate statistical tests based on experimental design and data distribution

  • Report both p-values and effect sizes (Cohen's d, fold change)

  • Consider correction for multiple comparisons if analyzing many conditions

  • Calculate confidence intervals to assess precision of measurements

Step 3: Biological Interpretation
Contextualize findings within biological frameworks:

  • Consider magnitude of change (fold-change threshold of biological relevance)

  • Compare with known expression patterns of related NTPDase family members

  • Assess correlation with physiological or pathological states

  • Evaluate consistency with existing literature on ENTPD4 regulation

Step 4: Functional Implications
Connect expression changes to potential functional outcomes:

  • Determine if protein levels correlate with observed mRNA changes

  • Assess enzymatic activity in relation to expression levels

  • Consider compensatory changes in related enzymes or pathways

  • Evaluate downstream effects on purinergic signaling

Interpretation Framework:

Expression ChangePotential InterpretationRecommended Follow-up
Significant increase (>2-fold)Upregulation suggesting functional importanceProtein expression confirmation, enzymatic activity assays
Modest increase (1.2-2 fold)Subtle regulatory changeTemporal analysis, additional biological replicates
No significant changeStable expression despite treatmentConsider post-translational regulation, subcellular localization
Modest decrease (0.5-0.8 fold)Partial downregulationFunctional impact assessment, compensatory mechanisms
Significant decrease (<0.5 fold)Major suppression of expressionKnockdown validation, rescue experiments

Remember that "biological variability is a key consideration. Analyzing one sample once can indicate a certain process is occurring but doesn't show trends or validate that process for that sample type" .

What approaches should be used to validate antibodies for detecting mouse ENTPD4 protein?

Validating antibodies for mouse ENTPD4 detection requires a comprehensive approach to ensure specificity, sensitivity, and reproducibility. The following methodological framework addresses both basic and advanced validation requirements:

Step 1: In Silico Validation

  • Verify target sequence is unique to ENTPD4 among NTPDase family members

  • Confirm antibody epitope conservation in mouse ENTPD4 isoforms

  • Check cross-reactivity potential with other mouse proteins using sequence alignment tools

  • Review manufacturer's validation data (if commercial antibody)

Step 2: Positive and Negative Controls

  • Positive controls:

    • Recombinant mouse ENTPD4 protein

    • Tissues/cells known to express high levels of ENTPD4

    • ENTPD4-overexpressing transfected cells

  • Negative controls:

    • ENTPD4 knockout or knockdown samples

    • Tissues/cells known not to express ENTPD4

    • Pre-immune serum or isotype control antibodies

Step 3: Western Blot Validation

  • Confirm single band of expected molecular weight

  • Demonstrate band disappearance in knockout/knockdown samples

  • Perform peptide competition assay to confirm specificity

  • Assess reproducibility across different sample preparations

Step 4: Immunohistochemistry/Immunofluorescence Validation

  • Compare staining pattern with known ENTPD4 distribution

  • Demonstrate absence of staining in knockout samples

  • Test multiple fixation protocols to optimize epitope accessibility

  • Perform co-localization studies with subcellular markers

Step 5: Advanced Validation

  • Immunoprecipitation followed by mass spectrometry

  • Multiple antibodies targeting different epitopes

  • Correlation of protein detection with mRNA expression

  • Cross-validation using orthogonal methods (e.g., reporter gene assays)

Validation Documentation Table:

Validation ParameterMethodAcceptance CriteriaDocumentation
SpecificityWestern blotSingle band at expected MW; absent in KOImages with molecular weight markers
SensitivityTitration experimentSignal detection at <100 ng proteinLimit of detection calculation
ReproducibilityTechnical replicatesCV <15% between experimentsStatistical analysis
Application versatilityMultiple techniquesConsistent results across methodsComparative analysis table
Lot-to-lot consistencyComparison testingEquivalent performanceSide-by-side testing results

This systematic validation approach ensures reliable and reproducible detection of mouse ENTPD4 protein, providing confidence in experimental results and interpretations.

How does ENTPD4 interact with other components of purinergic signaling pathways in mice?

Understanding ENTPD4's interactions within the broader purinergic signaling network requires a systems biology perspective. While direct evidence for ENTPD4-specific interactions is limited, we can construct a framework based on known NTPDase family interactions:

Purinergic Signaling Components:

  • Nucleotide Release Mechanisms:

    • Vesicular release (regulated exocytosis)

    • Channel-mediated release (connexins, pannexins)

    • Transporter-mediated release

    • Cell damage/lysis (pathological conditions)

  • Ectonucleotidase Cascade:

    • NTPDases (including ENTPD4) - convert ATP/ADP to AMP

    • Ecto-5'-nucleotidase (CD73) - converts AMP to adenosine

    • Alkaline phosphatases - broad substrate specificity

  • Purinergic Receptors:

    • P2X receptors (ionotropic, ATP-gated)

    • P2Y receptors (metabotropic, respond to ATP, ADP, UTP, UDP)

    • Adenosine receptors (A1, A2A, A2B, A3)

Hypothesized ENTPD4 Interactions:

ENTPD4 likely functions as a regulatory component of this network, potentially influencing:

  • Nucleotide Concentration Gradients:
    ENTPD4 may create localized microenvironments with altered nucleotide ratios, affecting receptor activation thresholds.

  • Temporal Regulation:
    By controlling the rate of nucleotide hydrolysis, ENTPD4 might modulate the duration of purinergic signaling events.

  • Cross-talk with Other Signaling Systems:
    Purinergic signaling interacts with growth factor signaling (PDGF, bFGF), insulin signaling, and multiple downstream pathways including phospholipase C/D, PI3K, and MAPK .

Experimental Approaches to Study ENTPD4 Interactions:

Experimental ApproachMethodologyExpected Insights
Enzyme kinetic studiesIn vitro substrate competition assaysSubstrate preference and regulatory mechanisms
Proximity labelingBioID or APEX2 fusion proteinsENTPD4 protein interaction partners
Co-immunoprecipitationPull-down with anti-ENTPD4 antibodiesDirect protein-protein interactions
FRET/BRET analysisFluorescently tagged ENTPD4 and partnersDynamic interactions in living cells
Transcriptomics after ENTPD4 manipulationRNA-seq following knockout/overexpressionPathway-level responses to ENTPD4 activity
Mathematical modelingComputational simulation of the purinergic networkSystem-level effects of ENTPD4 perturbation

Understanding these interactions could reveal how ENTPD4 contributes to the "specificity dictated by three essential modulatory components: the derivation of extracellular nucleotides, the expression of specific receptors, and select ectonucleotidases that dictate cellular responses" .

What approaches should be used to study ENTPD4's role in cellular metabolism and tissue homeostasis?

Investigating ENTPD4's role in cellular metabolism and tissue homeostasis requires a multifaceted approach that integrates molecular, cellular, and physiological methods. The following research strategy provides a comprehensive framework:

1. Genetic Manipulation Approaches:

  • Conditional knockout models: Generate tissue-specific ENTPD4 knockout mice using Cre-loxP system to study tissue-specific functions

  • Inducible systems: Employ tetracycline-inducible expression systems to control ENTPD4 levels temporally

  • CRISPR/Cas9 editing: Create precise mutations to study structure-function relationships

  • Overexpression models: Develop transgenic mice with enhanced ENTPD4 expression to identify gain-of-function phenotypes

2. Metabolic Profiling:

  • Extracellular metabolite analysis: Measure changes in extracellular nucleotide profiles using HPLC, mass spectrometry

  • Metabolic flux analysis: Apply isotope labeling to track metabolic pathways affected by ENTPD4 activity

  • Real-time metabolic monitoring: Use biosensors to detect dynamic changes in nucleotide levels in cellular microenvironments

  • Multi-omics integration: Combine metabolomics with transcriptomics and proteomics for systems-level understanding

3. Cellular Function Assessment:

  • Cell type-specific analyses: Investigate ENTPD4 function in specific cell populations (neurons, immune cells, endothelial cells)

  • Organotypic cultures: Study ENTPD4 in complex tissue environments that maintain native cellular architecture

  • Cell stress responses: Examine how ENTPD4 modulates cellular adaptation to metabolic stress, hypoxia, or inflammation

  • Signal transduction analysis: Map how ENTPD4 activity influences downstream signaling pathways using phosphoproteomics

4. Physiological Readouts:

  • Tissue homeostasis markers: Measure tissue-specific functional parameters (e.g., blood flow, inflammatory markers)

  • Challenge models: Subject ENTPD4-modified animals to physiological challenges (exercise, fasting, inflammation)

  • Aging studies: Assess how ENTPD4 function changes across lifespan and impacts age-related processes

  • Disease models: Introduce ENTPD4 modifications into established disease models to evaluate protective or detrimental effects

5. Translational Approaches:

  • Pharmacological targeting: Develop specific inhibitors or activators of ENTPD4 to modulate function

  • Human tissue analysis: Correlate findings from mouse models with human tissue samples

  • Biomarker development: Identify ENTPD4-related biomarkers indicative of metabolic or homeostatic disruption

Data Integration Framework:

Data TypeAnalytical ApproachIntegration Strategy
Enzyme activityKinetic modelingRelate to metabolite concentrations and cellular effects
Gene expressionNetwork analysisIdentify co-regulated genes and pathways
Metabolite profilesPathway enrichmentConnect to known metabolic functions
Physiological parametersCorrelation analysisLink molecular changes to organism-level effects
Intervention responsesComparative analysisDetermine context-dependent ENTPD4 functions

This comprehensive approach will help delineate how ENTPD4 contributes to the "regulation of purinergic signaling" and potentially impacts "cellular metabolism, adhesion, activation and migration with other protracted impacts upon developmental responses, inclusive of cellular proliferation, differentiation and apoptosis" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.