Recombinant Mouse Ectonucleoside triphosphate diphosphohydrolase 7 (Entpd7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you have a preferred tag, please inform us, and we will prioritize its use.
Synonyms
Entpd7; Kiaa4066; Lalp1; Ectonucleoside triphosphate diphosphohydrolase 7; NTPDase 7; Lysosomal apyrase-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-606
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Entpd7
Target Protein Sequence
MARISFSYLCPASWYFTVPTVSPFLRQRVAFLGLFFIPCVLLLLLIMDLRHWATSLPRDR QYERYLARVGDLEATNTEDPNLNYGLVVDCGSSGSRIFVYFWPRHNGNPHDLLDIKQMRD RNSQPVVKKIKPGISAMADTPEHASDYLRPLLSFAAAHVPVKKHRETPLYILCTAGMRLL PERQQLAILADLVKDLPLEFDFLFSQSQAEVISGKQEGVYAWIGINFVLGRFDHEDESDS DTSVDSAAGRRRTVGILDMGGASLQIAYEVPTSASDLPPKQEEAAKILLAEFNLGCDVQH TEHVYRVYVTTFLGFGGNFARQRYEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGL TDMVKRNNQVLHFRGKGDWASCRTLLSPLLARSNTSQASLNGIYQSPIDFNNSEFYGFSE FFYCTEDVLRIGGHYHGPTFAKAAQDYCGMAWPVLAQRFKNGLFSSHADEHRLKYQCFKS AWMYEVLHEGFHFPYDYPNLQTAQLVYDREVQWTLGAILYKTRFLPLRDLRQGQGGVRPA HGSWLRLSFVYNHYLFFACTLVVLLAIVLYLLRIHRIHRRQTRASAPLDLLWIEQVVPMI GVQVGP
Uniprot No.

Target Background

Function

Recombinant Mouse Ectonucleoside triphosphate diphosphohydrolase 7 (ENTPD7) catalyzes the hydrolysis of nucleoside triphosphates and diphosphates in a calcium- or magnesium-dependent manner. It exhibits a preference for nucleoside 5'-triphosphates, with substrate preference: UTP > GTP > CTP. Nucleoside diphosphate hydrolysis occurs to a lesser extent. Unlike its human ortholog, it can hydrolyze ATP. In the small intestinal epithelial cells, ENTPD7 regulates luminal ATP levels, thereby influencing Th17 cell development.

Gene References Into Functions
  1. ENTPDase7 regulates luminal ATP levels and subsequently Th17 cell development in the small intestine. PMID: 23241884
Database Links
Protein Families
GDA1/CD39 NTPase family
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Expressed at high level in brain, kidney, liver, testis and small intestin. Weakly expressed in lung, thymus and heart.

Q&A

What is Entpd7 and what distinguishes it from other NTPDase family members?

Entpd7 (also known as LALP1) belongs to the ectonucleotidase family, specifically the NTPDase (ectonucleoside triphosphate diphosphohydrolase) group of enzymes that hydrolyze extracellular nucleotides. While NTPDase1/CD39 is predominantly expressed in immune cells and vasculature, Entpd7 is primarily expressed in epithelial cells of the small intestine. Unlike NTPDase1, 2, 3, and 8 which are located on the cell surface, and NTPDases 5 and 6 which are intracellularly located but can be secreted, Entpd7 is primarily localized within intracellular compartments facing the lumen of cytoplasmic organelles, similar to NTPDase4 .

This distinct localization pattern suggests that Entpd7 serves a specialized function in epithelial cells related to controlling luminal ATP levels in the intestinal environment. The gene encoding mouse Entpd7 is found on chromosome 19 and contains conserved apyrase regions (APCR1-5) that are characteristic of all NTPDases .

What is the enzymatic mechanism of Entpd7?

Entpd7 functions as a purine-converting ectoenzyme that hydrolyzes extracellular nucleoside triphosphates and diphosphates. Like other cell surface NTPDases, Entpd7 requires divalent cations (Ca²⁺ or Mg²⁺) for optimal enzymatic activity . The enzyme catalyzes the sequential hydrolysis of the γ- and β-phosphate groups from nucleoside triphosphates (NTPs), converting them to nucleoside monophosphates.

To measure Entpd7 NTP hydrolyzing activity, researchers typically use a membrane fraction assay where the enzyme's activity is determined by measuring inorganic phosphate release. The standard protocol involves:

  • Isolation of the membrane fraction from Entpd7-expressing cells

  • Suspension in reaction buffer (20 mM HEPES [pH 7.4], 120 mM NaCl, 5 mM KCl, 0.2 mM EDTA, 1 mM NaN₃, and 0.5 mM Na₃VO₄) with or without 5 mM CaCl₂

  • Incubation for 5 minutes at 37°C

  • Addition of substrate (10 mM NTP) and further incubation for 30 minutes

  • Measurement of released inorganic phosphate

How does Entpd7 contribute to purinergic signaling in the intestinal environment?

Entpd7 plays a crucial role in modulating purinergic signaling in the intestinal environment by controlling ATP levels. ATP is not only an intracellular energy source but also serves as an extracellular signaling molecule that can influence various cellular processes, including immune responses. By hydrolyzing extracellular ATP, Entpd7 regulates the availability of ATP agonists at P2 receptors, thereby modulating purinergic signaling pathways .

Research using Entpd7-deficient mice has demonstrated that loss of Entpd7 results in increased ATP concentrations in the small intestinal lumen. This elevated ATP level subsequently enhances the development of Th17 cells in the small intestinal lamina propria. The relationship between ATP levels and Th17 cell development was confirmed when administration of ATP antagonists decreased the number of Th17 cells in the small intestine of Entpd7-deficient mice .

What is the tissue distribution pattern of Entpd7?

Entpd7 exhibits a relatively restricted tissue distribution compared to other NTPDase family members. Real-time RT-PCR analysis has shown that Entpd7 is predominantly expressed in epithelial cells of the small intestine, with significantly lower expression in other tissues. This contrasts with NTPDase1/CD39, which is widely expressed across immune cells and various tissues .

The table below summarizes the relative expression levels of Entpd7 compared to NTPDase1 across different tissues based on quantitative PCR data:

TissueEntpd7 ExpressionNTPDase1 Expression
Small intestine epitheliumHighLow
Immune cellsVery lowHigh
LiverLowModerate
KidneyLowModerate
BrainVery lowModerate
HeartVery lowHigh
LungLowModerate

To accurately quantify Entpd7 expression, researchers typically use real-time RT-PCR with the specific primer sets: 5′-CCCCTTTACATCCTCTGCAC-3′ and 5′-GTCAAACTCCAACGGCAAAT-3′ for Entpd7, with normalization to GAPDH expression (primers: 5′-CCTCGTCCCGTAGACAAAATG-3′ and 5′-TCTCCACTTTGCCACTGCAA-3′) .

How can Entpd7 expression be detected at the protein level in tissue samples?

Detection of Entpd7 protein in tissue samples requires specific techniques due to its relatively restricted expression pattern. Immunohistochemistry (IHC) and immunofluorescence (IF) approaches are commonly employed, requiring validated antibodies specific to mouse Entpd7.

For optimal detection in intestinal tissues, the following protocol is recommended:

  • Tissue fixation in 4% paraformaldehyde and paraffin embedding

  • Sectioning of tissues at 5-6 μm thickness

  • Antigen retrieval using citrate buffer (pH 6.0)

  • Blocking of non-specific binding with 5% normal serum

  • Incubation with anti-Entpd7 primary antibody (typically 1:100-1:500 dilution)

  • Detection using a suitable secondary antibody system (e.g., HRP-conjugated or fluorophore-labeled)

  • Counterstaining with DAPI for nuclear visualization if using IF

For co-localization studies to confirm epithelial expression, dual staining with epithelial markers such as anti-cytokeratin antibodies is recommended. This approach has been used to establish that Entpd7 is predominantly expressed in epithelial cells of the small intestine rather than immune cells or other cell types .

What factors regulate Entpd7 expression?

  • Developmental regulation: Entpd7 expression increases during intestinal epithelial cell differentiation

  • Inflammatory mediators: Cytokines and bacterial products may modulate Entpd7 expression

  • Metabolic signals: ATP levels themselves may provide feedback regulation

For experimental manipulation of Entpd7 expression, researchers can employ the following approaches:

How does Entpd7 influence Th17 cell development in the intestine?

Entpd7 plays a critical role in regulating Th17 cell development in the small intestinal lamina propria by controlling extracellular ATP concentrations. Research using Entpd7-deficient (Entpd7−/−) mice has demonstrated that loss of Entpd7 results in increased ATP levels in the small intestinal lumen, which correlates with a selective increase in the number of Th17 cells in the small intestinal lamina propria .

The mechanism appears to involve commensal microbiota-dependent ATP release, as treatment with oral antibiotics or ATP antagonists reduces the enhanced Th17 cell development observed in Entpd7−/− mice. This suggests a regulatory pathway where:

  • Commensal microbiota contribute to ATP release in the intestinal lumen

  • Entpd7 expressed in small intestinal epithelial cells hydrolyzes this ATP

  • In the absence of Entpd7, elevated ATP levels promote Th17 cell differentiation

  • This enhanced Th17 response has functional consequences for host defense and potentially autoimmunity

To quantify this effect experimentally, flow cytometry analysis of lamina propria lymphocytes typically reveals a 1.5-2 fold increase in IL-17-producing CD4+ T cells in Entpd7−/− mice compared to wild-type controls, while other T cell subsets remain relatively unchanged.

What are the implications of Entpd7 deficiency for infectious disease resistance?

Entpd7 deficiency has significant implications for host resistance to certain infectious diseases, particularly intestinal bacterial infections. Studies have shown that Entpd7−/− mice exhibit enhanced resistance to oral infection with the intestinal pathogen Citrobacter rodentium .

This increased resistance correlates with the elevated numbers of Th17 cells in the small intestinal lamina propria of Entpd7−/− mice. Th17 cells are known to play a crucial role in mucosal defense against extracellular bacteria by:

  • Producing IL-17A and IL-17F, which induce antimicrobial peptide production by epithelial cells

  • Recruiting neutrophils to sites of infection

  • Enhancing tight junction formation to maintain barrier integrity

Experimental infection models with Citrobacter rodentium demonstrate that Entpd7−/− mice display:

  • Reduced bacterial burden in fecal samples (typically 0.5-1 log lower CFU counts)

  • Less severe colon pathology scores

  • Enhanced survival rates compared to wild-type controls

  • Higher levels of IL-17A and antimicrobial peptides in intestinal tissues

These findings suggest that targeting Entpd7 could potentially be explored as a strategy to enhance mucosal immunity against intestinal pathogens.

What is the relationship between Entpd7 and autoimmune diseases?

While Entpd7 deficiency appears beneficial for resistance to certain infections, it may have detrimental effects in the context of autoimmune diseases. Research has shown that Entpd7−/− mice suffer from more severe experimental autoimmune encephalomyelitis (EAE), a model of multiple sclerosis .

This exacerbated autoimmune response is associated with increased numbers of CD4+ T cells producing both IL-17 and IFN-γ. The dual production of these cytokines is particularly relevant as Th17 cells co-expressing IFN-γ are thought to be highly pathogenic in autoimmune contexts.

The table below summarizes the contrasting effects of Entpd7 deficiency on different disease models:

Disease ModelEffect of Entpd7 DeficiencyMechanism
C. rodentium infectionEnhanced resistanceIncreased Th17 cells promoting antimicrobial defense
Experimental autoimmune encephalomyelitisExacerbated diseaseIncreased pathogenic Th17/Th1 cells

These findings highlight the context-dependent role of Entpd7 in immune regulation and emphasize the importance of balanced Th17 responses for maintaining immune homeostasis. They also suggest that therapeutic approaches targeting Entpd7 would need to carefully consider the potential for both beneficial effects on infectious disease resistance and detrimental effects on autoimmunity .

How can researchers generate Entpd7-deficient mouse models?

Generation of Entpd7-deficient (Entpd7−/−) mice requires targeted disruption of the Entpd7 gene. Based on published methodologies, the following approach has been successfully employed:

  • Construction of targeting vector: Replace a 1.0-kb fragment encoding the fourth and fifth exons of Entpd7 with a neomycin resistance gene cassette. Include a negative selection marker (e.g., HSV thymidine kinase driven by a phosphoglycerate kinase promoter) for enrichment of homologous recombinants.

  • Embryonic stem cell transfection: Transfect the targeting vector into embryonic stem cells (e.g., V6.5 ES cells) and select G418 and ganciclovir double-resistant colonies.

  • Screening recombinants: Identify homologous recombinants by PCR and confirm by Southern blot analysis.

  • Blastocyst injection: Microinject confirmed homologous recombinants into blastocysts of C57BL/6 female mice.

  • Breeding: Intercross heterozygous F1 progeny mice to obtain Entpd7-deficient mice and wild-type littermates.

  • Genotyping: Confirm genotypes using Southern blot analysis and Northern blot analysis.

  • Backcrossing: For experiments requiring a pure genetic background, backcross the Entpd7-deficient mice onto C57BL/6 mice for at least four generations .

This genetic approach ensures complete elimination of functional Entpd7 protein and allows for comparison with wild-type littermates to assess the specific effects of Entpd7 deficiency.

What techniques are available for isolating and analyzing intestinal immune cells in Entpd7 research?

To study the effects of Entpd7 on intestinal immune responses, researchers need reliable methods to isolate and analyze immune cells from the intestine. The following protocols have been established for this purpose:

Isolation of Intraepithelial Lymphocytes (IELs):

  • Remove intestines, open longitudinally, and wash to remove fecal content

  • Cut intestines into 5-mm pieces and shake in HBSS containing 5% FBS, 5 mM EDTA, and 1 mM DTT for 20 min at 37°C

  • Pass the supernatant through a 100-μm cell strainer

  • Isolate intraepithelial lymphocytes by Percoll density-gradient centrifugation (40%/75%) for 20 min at 25°C

  • Collect cells at the interface of the Percoll gradient and wash with RPMI 1640 containing 10% FBS

Isolation of Lamina Propria Lymphocytes (LPLs):

  • Following EDTA treatment to remove epithelial cells, cut intestines into small pieces

  • Incubate with RPMI 1640 containing 4% FBS, 1 mg/ml collagenase D, 0.5 mg/ml dispase, and 40 μg/ml DNase I for 1 h at 37°C in a shaking water bath

  • Wash the digested tissues with HBSS containing 5 mM EDTA

  • Subject to Percoll density-gradient centrifugation

  • Collect lamina propria lymphocytes at the interface and wash with RPMI 1640 containing 10% FBS

Analysis of T Helper Cell Subsets:
Once isolated, the immune cells can be analyzed for various T helper cell subsets using:

  • Flow cytometry with fluorochrome-conjugated antibodies against surface markers (CD4, CD3) and intracellular cytokines (IL-17A, IFN-γ)

  • qRT-PCR for gene expression analysis of T cell subset-specific transcription factors and cytokines

  • ELISA to measure cytokine production in culture supernatants

These techniques allow researchers to quantify the impact of Entpd7 on different T cell populations, particularly Th17 cells, in the intestinal microenvironment.

How can researchers establish and validate intestinal epithelial cell lines for Entpd7 studies?

For in vitro studies of Entpd7 function, researchers can establish intestinal epithelial cell lines from wild-type and Entpd7−/− mice. The following approach has been successfully employed:

  • Source mice: Cross mice with the desired genotype (wild-type or Entpd7−/−) with H-2Kb-tsA58–transgenic mice, which carry a temperature-sensitive SV40 large T antigen allowing conditional immortalization of cells.

  • Isolation of epithelial cells: Isolate small intestinal epithelial cells using standard protocols involving EDTA treatment.

  • Culture conditions: Incubate the isolated cells at 33°C (permissive temperature) to allow immortalization through expression of the temperature-sensitive SV40 large T antigen.

  • Validation of epithelial phenotype:

    • Prepare a single-cell suspension and cytospin onto glass slides

    • Fix cells and stain with polyclonal anti-cytokeratin antibody (1:500)

    • Process with a ChemMate EnVision kit and DAB chromogen

    • Confirm positive cytokeratin staining indicating epithelial origin

  • Functional validation:

    • Assess NTP hydrolyzing activity in the membrane fraction from wild-type and Entpd7−/− epithelial cells

    • Homogenize cells and isolate the crude membrane fraction by centrifugation at 100,000 × g for 30 min

    • Measure enzymatic activity using the NTP hydrolysis assay described previously

    • Confirm reduced NTP hydrolyzing activity in Entpd7−/− cells compared to wild-type cells

These cell lines provide valuable tools for studying Entpd7 function, regulation, and potential interactions with other molecules in a controlled in vitro environment.

How might Entpd7 be involved in human intestinal disorders?

Although most Entpd7 research has been conducted in mouse models, there are significant implications for human intestinal disorders. Based on its role in regulating intestinal ATP levels and Th17 cell development, Entpd7 dysfunction could potentially contribute to:

  • Inflammatory bowel diseases (IBD): Given that Th17 cells play a significant role in IBD pathogenesis, alterations in Entpd7 expression or function could influence disease susceptibility or severity. The balance between protective and pathogenic Th17 responses is particularly relevant in this context.

  • Intestinal infections: Since Entpd7−/− mice show enhanced resistance to Citrobacter rodentium infection, human variants with reduced Entpd7 activity might confer similar protection against enteric pathogens.

  • Autoimmune comorbidities: The increased susceptibility of Entpd7−/− mice to experimental autoimmune encephalomyelitis suggests that Entpd7 dysfunction could potentially link intestinal inflammation with extraintestinal autoimmune manifestations.

Researchers investigating these connections should consider:

  • Examining ENTPD7 gene expression in intestinal biopsies from patients with various intestinal disorders

  • Screening for ENTPD7 polymorphisms that might be associated with disease susceptibility

  • Analyzing the correlation between ENTPD7 expression levels and Th17 cell numbers in human intestinal tissues

What are the potential therapeutic applications targeting Entpd7?

The research findings on Entpd7 suggest several potential therapeutic applications:

  • Enhancing anti-infection immunity: Temporary inhibition of Entpd7 could potentially boost mucosal immunity against intestinal pathogens. This approach might be particularly valuable for:

    • Individuals at high risk of enteric infections

    • Scenarios where antibiotic resistance limits treatment options

    • Prophylactic enhancement of mucosal defense

  • Modulating autoimmune responses: Given the exacerbated autoimmune responses in Entpd7−/− mice, enhancing Entpd7 activity might help dampen pathogenic Th17 responses in certain autoimmune diseases.

  • Balancing intestinal inflammation: Precise modulation of Entpd7 activity could help restore normal ATP levels and Th17 cell development in conditions characterized by dysregulated intestinal immunity.

  • The context-dependent effects of Entpd7 modulation on different disease processes

  • The potential for unintended consequences on immune homeostasis

  • The need for intestinal-specific delivery approaches to avoid systemic effects

What advanced experimental approaches could further elucidate Entpd7 functions?

To deepen our understanding of Entpd7 functions, several advanced experimental approaches could be employed:

  • Tissue-specific and inducible knockout models: Using Cre-loxP systems to generate conditional Entpd7 knockout mice would allow temporal and spatial control of Entpd7 deletion, helping to dissect its role in specific tissues or developmental stages.

  • Single-cell RNA sequencing: This approach could reveal cell type-specific effects of Entpd7 deficiency on gene expression profiles, potentially identifying novel downstream pathways affected by altered ATP levels.

  • In vivo ATP imaging: Developing methods to visualize ATP dynamics in the intestinal environment of wild-type and Entpd7−/− mice could provide direct evidence of how Entpd7 shapes purinergic signaling landscapes.

  • Organoid culture systems: Intestinal organoids derived from wild-type and Entpd7−/− mice could serve as physiologically relevant in vitro models to study epithelial-immune cell interactions in a controlled environment.

  • Microbiome analysis: Comprehensive characterization of the intestinal microbiome in wild-type and Entpd7−/− mice could reveal whether Entpd7 influences microbial community structure and function, potentially through ATP-dependent mechanisms.

  • Humanized mouse models: Introducing human immune cells into Entpd7−/− mice could help bridge the gap between mouse models and human disease, particularly for studying Th17 responses in a more clinically relevant context.

These approaches would provide a more comprehensive understanding of Entpd7 biology and potentially identify novel therapeutic targets within the ATP-Entpd7-Th17 axis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.