Recombinant Mouse Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 (Enpp5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Enpp5; Ectonucleotide pyrophosphatase/phosphodiesterase family member 5; E-NPP 5; NPP-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-477
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Enpp5
Target Protein Sequence
PEEQKVLVVSFDGFRWDYLYKVPTPHFHYIMKNGVHVNQVTNVFITKTYPNHYTLVTGLF AENHGIVANDMFDPILNKSFSLEHMDIYDSKFWEEATPIWITNQRAGHASGAAMWPGADV KIHDSFPTYYLPYNESVSFEDRVAKIIEWFTAKDPINLGFLYWEEPDDTGHDVGPDSPLM GSVISDVDHKLGYLIKMLKRAKLWNNVNLIVTSDHGMTQCSKQRVIELDRYLDKEHYTLI DHSPVAAILPKEGKFDEVYDALAGAHPNLTVYKKEEIPERWHYKHNDRVQPIVAVADEGW YILQNKSDDFLLGNHGYDNALAEMHPIFLAHGPAFRKNFTKEAMNSTDLYSLLCHLLNLT ALPHNGSFWNVQDLLSSATPKPIPYTQSTTLLLGSDKPGEDEQEESYPYYIGVSLGSIIA MVFFVVLIKHLIRSQVHTLQYRQVEVAQPLLQA
Uniprot No.

Target Background

Function
Hydrolyzes NAD but not nucleotide di- and triphosphates. Lacks lysopholipase D activity. It may play a role in neuronal cell communication.
Database Links
Protein Families
Nucleotide pyrophosphatase/phosphodiesterase family
Subcellular Location
Secreted. Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed abundantly in the brain and kidney, and at lower levels in the liver.

Q&A

What is mouse ENPP5 and how does it function within the ENPP family?

Mouse ENPP5 belongs to the ectonucleotide pyrophosphatase/phosphodiesterase family, a group of ecto-enzymes that regulate the availability of extracellular nucleotides . This enzyme family forms a subgroup of a larger family that includes arylsulfatases, phosphopentomutases, 2,3-bisphosphoglycerate-independent phosphoglycerate mutases, and alkaline phosphatases . ENPP5 functions primarily as a phosphodiesterase, cleaving specific substrates such as UDP-glucose (UDPG) and ADP-ribose (ADPR) .

Unlike other ENPP family members such as ENPP1, ENPP3, and ENPP4 that primarily hydrolyze nucleotide-based substrates, ENPP5 has evolved distinct substrate specificities. The catalytic mechanism of ENPP5 involves a two-step in-line displacement process similar to that of alkaline phosphatases, where a threonine residue serves as the catalytic nucleophile activated by a zinc ion .

Functionally, ENPP5 contributes to extracellular nucleotide metabolism, which has implications for various physiological processes including immune response regulation, cell signaling, and potentially disease pathogenesis.

What are the key structural features of mouse ENPP5?

Mouse ENPP5 shares structural similarities with other ENPP family members but possesses several distinctive features that influence its function. The protein contains a phosphodiesterase/nucleotide pyrophosphatase domain within its extracellular region . The PDE domain of ENPP5, like other family members, is fairly well conserved, sharing 23% to 61% identity with other human ENPPs .

Several unique structural features distinguish ENPP5:

  • Catalytic Site: The catalytic site contains three zinc ions, whereas most other ENPPs contain only two . The third Zn²⁺ ion is coordinated by an aspartate (Asp192) and a glutamate (Glu159) and interacts with the 2′ and 3′ oxygens of ribose substrates .

  • Nucleotide-Binding Slot: ENPP5 uniquely contains a tyrosine (Tyr73) in the nucleotide-binding slot, rather than phenylalanine as found in other family members . This structural difference significantly influences substrate recognition and specificity.

  • Catalytic Environment: The catalytic site environment of ENPP5 is negatively charged, similar to that of ENPP4, which contributes to its substrate preferences .

These structural features collectively determine ENPP5's distinctive enzymatic properties and substrate specificity profile.

How does recombinant mouse ENPP5 compare biochemically to other ENPP family members?

Recombinant mouse ENPP5 exhibits distinct biochemical properties compared to other ENPP family members. While ENPP1-3 are known to hydrolyze nucleotides and their derivatives, and ENPP2 (Autotaxin) exhibits lysophospholipase D activity, ENPP5 has evolved specialized substrate preferences .

ENPP5 demonstrates biochemical differences in several aspects:

  • Substrate Specificity: Unlike ENPP1 which efficiently hydrolyzes ATP to generate AMP and pyrophosphate, ENPP5 preferentially cleaves substrates such as UDP-glucose and ADP-ribose . Mutational studies have shown that reversing the tyrosine to phenylalanine in the nucleotide-binding slot enables NTP hydrolysis, suggesting evolutionary specialization of ENPP5's activity .

  • Catalytic Mechanism: Although ENPP5 utilizes a similar associative two-step in-line displacement mechanism as other family members, its unique third zinc ion and catalytic site environment modify its enzymatic behavior .

  • Activity Measurement: While standard phosphodiesterase activity assays such as those using bis(p-nitrophenyl) phosphate can be adapted for ENPP family members, substrate concentrations and reaction conditions must be optimized specifically for ENPP5 due to its distinct catalytic properties .

These biochemical differences reflect evolutionary divergence within the ENPP family, resulting in specialized enzymatic functions for each member.

What expression systems are most effective for producing functional recombinant mouse ENPP5?

Based on established protocols for related ENPP family members, several expression systems can be effectively employed for producing functional recombinant mouse ENPP5:

  • Mammalian Expression Systems: HEK293 or CHO cells typically provide proper folding and post-translational modifications essential for ENPP5 activity. Similar to recombinant ENPP2 production, mouse ENPP5 can be expressed without its transmembrane and intracellular domains, resulting in secretion of the recombinant enzyme into culture media .

  • Tag Design: A C-terminal polyhistidine tag (similar to the human ENPP5 with a C-terminal 10-His tag) or an N-terminal 6-His tag (similar to recombinant mouse ENPP2) can facilitate purification without interfering with enzymatic activity. For mouse ENPP5, expressing the protein as Pro25-Ser430 with appropriate tags generally yields functional protein.

  • Purification Strategy: A two-step purification process typically yields high-quality recombinant protein:

    • Initial capture via immobilized metal affinity chromatography (IMAC)

    • Polishing step using size exclusion chromatography to achieve >95% purity

  • Quality Control: Successful expression should be verified through:

    • SDS-PAGE to confirm size (~50 kDa for the core protein, with variations based on glycosylation)

    • Western blotting with anti-His and anti-ENPP5 antibodies

    • Activity assays using specific substrates

When designing expression constructs, it's critical to exclude the transmembrane and cytoplasmic domains while preserving the catalytic extracellular region to ensure proper folding and enzymatic function.

What are the recommended substrates for assessing mouse ENPP5 enzymatic activity?

Several substrates can be used to assess mouse ENPP5 enzymatic activity, with selection depending on the specific research question:

  • Natural Substrates: Based on biochemical characterization, UDP-glucose (UDPG) and ADP-ribose (ADPR) are physiologically relevant substrates for ENPP5 . These provide the most biologically meaningful assessment of enzyme function.

  • Synthetic Substrates: O-(4-Nitrophenylphosphoryl) choline can be used as evidenced by its successful application with human ENPP5 . This substrate offers a convenient colorimetric readout for high-throughput screening.

  • Generic Phosphodiesterase Substrates: Bis(p-nitrophenyl) phosphate sodium salt (BPNPP) used for ENPP2 activity assays can be adapted for ENPP5 . A typical protocol would include:

    • Diluting the enzyme to 2 ng/μL in appropriate assay buffer

    • Preparing substrate at 2 mM concentration

    • Combining 50 μL enzyme with 50 μL substrate

    • Incubating at room temperature for 10 minutes

    • Stopping the reaction with 100 μL of 0.2 M NaOH

    • Measuring absorbance at 405 nm

  • Control Considerations: Include substrate blanks (buffer + substrate) and heat-inactivated enzyme controls to account for non-enzymatic hydrolysis.

When developing activity assays, researchers should optimize pH, divalent cation concentrations (particularly zinc and magnesium), and temperature conditions specifically for mouse ENPP5 rather than assuming identical conditions to other ENPP family members.

How does the unique tyrosine (Tyr73) in mouse ENPP5's nucleotide-binding slot affect substrate recognition?

The presence of tyrosine (Tyr73) in mouse ENPP5's nucleotide-binding slot represents a critical structural distinction from other ENPP family members, which typically contain phenylalanine in this position . This single amino acid substitution fundamentally alters ENPP5's substrate recognition profile and enzymatic capabilities.

Mechanistic studies have revealed that the hydroxyl group of Tyr73 creates steric hindrance within the nucleotide-binding slot, effectively preventing efficient binding of nucleotide triphosphate substrates . Experimental evidence demonstrates that reversing this mutation (eliminating the hydroxyl group) enables NTP hydrolysis, confirming this residue's gatekeeper role in substrate discrimination .

The functional consequences of this tyrosine substitution include:

  • Restricted Nucleotide Binding: The hydroxyl group creates spatial constraints that clash with certain nucleotide substrates, directing ENPP5 toward alternative substrates like UDP-glucose and ADP-ribose .

  • Modified π-π Stacking Interactions: While other ENPPs utilize phenylalanine for π-π stacking with nitrogenous bases, the tyrosine in ENPP5 alters these interactions, contributing to its distinct substrate preferences.

  • Evolutionary Specialization: This substitution likely represents evolutionary divergence toward specialized substrate processing, distinguishing ENPP5's physiological role from other family members.

Researchers investigating ENPP5 should consider this structural feature when designing inhibitors or substrate analogs, as compounds accommodating the tyrosine residue will demonstrate greater specificity for ENPP5 over other family members.

What is the significance of the third zinc ion in ENPP5's catalytic mechanism?

The presence of a third zinc ion in ENPP5's catalytic site represents a distinctive structural feature that significantly influences its enzymatic mechanism and substrate specificity . While most ENPP family members contain two zinc ions essential for catalysis, ENPP5 contains this additional zinc that modifies its catalytic behavior.

The third Zn²⁺ ion exhibits specific coordination and functional roles:

  • Coordination Pattern: This zinc ion is uniquely coordinated by an aspartate (Asp192) and a glutamate (Glu159), creating a distinct metal-binding site separate from the two catalytic zincs .

  • Substrate Interaction: Functionally, this third zinc ion interacts with the 2′ and 3′ oxygens of ribose substrates, providing additional binding energy and orientation control for specific substrates .

  • Catalytic Implications: By stabilizing the ribose moiety of substrates, this zinc ion likely contributes to:

    • Enhanced binding affinity for specific ribose-containing substrates

    • Precise positioning of substrates for nucleophilic attack

    • Modified transition state stabilization during catalysis

  • Evolutionary Adaptation: This additional zinc-binding site represents an evolutionary adaptation that directs ENPP5 toward specific physiological substrates distinct from those preferred by other family members.

How can ENPP5 function be investigated in cellular and in vivo models?

Investigating ENPP5 function in cellular and in vivo models requires multifaceted approaches spanning genetic, biochemical, and physiological techniques:

  • Genetic Manipulation Strategies:

    • CRISPR/Cas9-mediated knockout: Generate ENPP5-deficient cell lines or mouse models to study loss-of-function effects

    • Point mutation models: Create Tyr73Phe mutants to assess the importance of this residue in vivo

    • Conditional knockout models: Use tissue-specific promoters (e.g., Cre-lox system) to study organ-specific ENPP5 functions

  • Cellular Localization Studies:

    • Immunofluorescence with validated anti-ENPP5 antibodies to determine subcellular localization

    • Live-cell imaging using fluorescently tagged ENPP5 (ensuring tags don't interfere with trafficking or function)

    • Biochemical fractionation followed by Western blotting to assess membrane association

  • Functional Activity Assessment:

    • Develop cell-based assays measuring extracellular UDP-glucose or ADP-ribose levels

    • Employ mass spectrometry to quantify substrate and product levels in cellular media or tissue extracts

    • Monitor downstream signaling pathways affected by ENPP5-mediated nucleotide processing

  • Disease Model Applications:

    • Based on ENPP family involvement in immunity, cancer, and metabolism, ENPP5 knockout or inhibition can be studied in:

      • Tumor models (similar to ENPP1 studies in breast cancer)

      • Immune response models

      • Metabolic disease models

  • Validation Approaches:

    • Rescue experiments reintroducing wild-type or mutant ENPP5 into knockout models

    • Pharmacological approaches using selective inhibitors (when available)

    • Corroboration across multiple model systems (cell lines, primary cells, animal models)

What experimental considerations are important when designing phosphodiesterase activity assays for mouse ENPP5?

Designing robust phosphodiesterase activity assays for mouse ENPP5 requires careful consideration of multiple experimental parameters:

  • Buffer Composition Optimization:

    • pH: Typically pH 7.5-8.5 for optimal ENPP activity

    • Divalent cations: Include ZnCl₂ (typically 0.5-2 mM) to maintain the three zinc ions essential for ENPP5 catalysis

    • Salt concentration: 100-150 mM NaCl or KCl to maintain physiological ionic strength

    • Detergents: Low concentrations (0.01-0.05%) of non-ionic detergents may improve enzyme stability

  • Substrate Selection and Preparation:

    • For physiological relevance: UDP-glucose or ADP-ribose

    • For colorimetric detection: bis(p-nitrophenyl) phosphate (BPNPP) or O-(4-Nitrophenylphosphoryl) choline

    • Substrate concentration: Perform kinetic characterization to determine Km values (typically 0.1-10× Km for routine assays)

    • Stock preparation: Ensure complete solubilization; heating may be necessary for certain substrates

  • Reaction Conditions:

    • Temperature: 25°C (room temperature) or 37°C (physiological)

    • Reaction time: Establish linear range of activity (typically 5-30 minutes)

    • Enzyme concentration: Titrate to ensure linear response with respect to enzyme concentration

    • Stop solution: 0.2 M NaOH effectively terminates the reaction for colorimetric assays

  • Controls and Validation:

    • Substrate blanks: Include no-enzyme controls to account for spontaneous hydrolysis

    • Positive controls: Include known active phosphodiesterases (e.g., ENPP2) with validated substrates

    • Specificity controls: Include known ENPP inhibitors to confirm enzymatic specificity

    • Heat-inactivated enzyme: Confirm activity loss after thermal denaturation

  • Data Analysis:

    • Establish standard curves for colorimetric products

    • Calculate specific activities (μmol product/min/mg enzyme)

    • Perform Michaelis-Menten kinetic analysis to determine Km and Vmax

A sample protocol based on related ENPP assays would include diluting recombinant mouse ENPP5 to 2 ng/μL in appropriate buffer, adding equal volumes of 2 mM substrate, incubating for 10 minutes at room temperature, and stopping with 0.2 M NaOH before measuring absorbance at 405 nm .

How does mouse ENPP5 compare to human ENPP5 in terms of structure and function?

Mouse ENPP5 and human ENPP5 share significant structural and functional similarities, but also exhibit species-specific differences that are important for translational research:

  • Sequence Homology:

    • Mouse and human ENPP5 share approximately 85% amino acid sequence identity , indicating high conservation of core functional domains

    • The catalytic phosphodiesterase domain exhibits particularly high conservation, suggesting preserved enzymatic mechanism

  • Structural Features Comparison:

    • Both contain a phosphodiesterase/nucleotide pyrophosphatase domain in their extracellular region

    • The critical tyrosine (Tyr73) in the nucleotide-binding slot is conserved between species

    • The three zinc-binding sites appear to be preserved across species, maintaining the unique third zinc coordination characteristic of ENPP5

  • Functional Similarities:

    • Both exhibit phosphodiesterase activity toward specific substrates

    • Human ENPP5 demonstrates activity with O-(4-Nitrophenylphosphoryl) choline , suggesting similar substrate preferences to mouse ENPP5

    • Conserved catalytic mechanisms including the two-step in-line displacement process

  • Species-Specific Considerations:

    • Potential differences in glycosylation patterns may affect stability or cellular interactions

    • Species-specific variations in peripheral residues may modify substrate affinity or catalytic efficiency

    • Expression patterns across tissues may vary between mouse and human

  • Experimental Implications:

    • Recombinant proteins from both species typically express as approximately 50 kDa proteins

    • Cross-reactivity of antibodies should be verified when switching between species

    • Inhibitors may show species-specific potency differences despite high sequence conservation

What are common challenges in producing active recombinant mouse ENPP5 and how can they be addressed?

Researchers frequently encounter several challenges when producing active recombinant mouse ENPP5. These issues and their solutions include:

  • Low Expression Yield:

    • Challenge: Insufficient protein production in expression systems

    • Solutions:

      • Optimize codon usage for the expression host

      • Test different signal peptides to improve secretion efficiency

      • Evaluate alternative promoters (CMV, EF1α) for higher expression

      • Consider stable cell line generation for consistent production

  • Protein Misfolding and Inactivity:

    • Challenge: Expressed protein lacks enzymatic activity

    • Solutions:

      • Ensure proper disulfide bond formation by expressing in eukaryotic systems

      • Include molecular chaperones as co-expression partners

      • Optimize culture conditions (temperature reduction to 30°C during expression phase)

      • Verify zinc incorporation by supplementing growth media with ZnCl₂

  • Proteolytic Degradation:

    • Challenge: Protein degradation during expression or purification

    • Solutions:

      • Add protease inhibitors to culture media and all purification buffers

      • Optimize harvest timing to collect protein before degradation occurs

      • Consider fusion partners that enhance stability

      • Perform purification at 4°C to minimize proteolytic activity

  • Aggregation During Purification:

    • Challenge: Protein forms inactive aggregates

    • Solutions:

      • Include low concentrations (0.01-0.05%) of non-ionic detergents in buffers

      • Add 5-10% glycerol to stabilize protein structure

      • Optimize salt concentration (typically 150-300 mM NaCl)

      • Avoid freeze-thaw cycles; store in single-use aliquots

  • Loss of Zinc During Purification:

    • Challenge: Depletion of essential zinc ions

    • Solutions:

      • Supplement purification buffers with 10-50 μM ZnCl₂

      • Avoid strong chelators like EDTA in buffers

      • Use mild elution conditions during affinity chromatography

      • Verify zinc content using atomic absorption spectroscopy

A systematic approach to optimization, addressing each of these potential issues, typically yields functional recombinant mouse ENPP5 suitable for research applications.

How can researchers distinguish between ENPP5 activity and other phosphodiesterases in complex biological samples?

Distinguishing ENPP5 activity from other phosphodiesterases in complex biological samples requires strategic experimental design:

  • Substrate Specificity Profiling:

    • Utilize ENPP5's preference for UDP-glucose and ADP-ribose

    • Compare hydrolysis rates of these substrates against common nucleotides (ATP, GTP)

    • The unique substrate selectivity pattern can help differentiate ENPP5 from related enzymes

  • Selective Inhibition Approaches:

    • Apply specific inhibitors targeting different phosphodiesterase families:

      • Non-nucleotide phosphodiesterase inhibitors (e.g., IBMX) for cAMP/cGMP PDEs

      • Nucleotide analogs for general ENPP family inhibition

      • When available, ENPP5-selective inhibitors

    • Analyze the inhibition profile to distinguish between enzyme classes

  • Immunodepletion Strategies:

    • Use validated anti-ENPP5 antibodies to immunodeplete samples

    • Compare activity before and after immunodepletion

    • The activity difference represents ENPP5-specific contribution

  • Genetic Approaches:

    • Compare samples from wild-type and ENPP5 knockout models

    • Use siRNA or shRNA to knockdown ENPP5 in cellular systems

    • Overexpress ENPP5 and measure increased activity with specific substrates

  • Biochemical Separation:

    • Fractionate samples using ion exchange or size exclusion chromatography

    • Test each fraction for activity with ENPP5-selective substrates

    • Confirm ENPP5 presence in active fractions via Western blotting

  • Activity Measurement Under Selective Conditions:

    • Optimize reaction conditions to favor ENPP5:

      • pH optima (typically pH 7.5-8.5 for ENPP5)

      • Zinc dependency (ENPP5 requires zinc for activity)

      • Temperature preferences

These approaches, particularly when combined, allow researchers to attribute observed phosphodiesterase activity to ENPP5 with high confidence in complex biological samples.

What is known about the physiological roles of ENPP5 and how can these be experimentally investigated?

While specific physiological roles of ENPP5 remain less characterized than other ENPP family members, emerging evidence suggests several potential functions that can be experimentally investigated:

  • Nucleotide and Sugar-Nucleotide Metabolism:

    • Potential Role: ENPP5's ability to hydrolyze UDP-glucose and ADP-ribose suggests involvement in extracellular nucleotide sugar metabolism

    • Investigative Approaches:

      • Measure extracellular UDP-glucose and ADP-ribose levels in ENPP5-deficient models

      • Trace metabolic fate of labeled substrates in presence/absence of ENPP5

      • Analyze impact on glycosylation pathways that utilize nucleotide sugars

  • Immune System Regulation:

    • Potential Role: Other ENPP family members regulate immune responses (e.g., ENPP1 in cGAMP metabolism) , suggesting potential immune functions for ENPP5

    • Investigative Approaches:

      • Characterize immune cell populations and activation in ENPP5 knockout models

      • Challenge ENPP5-deficient animals with pathogens or immune stimulants

      • Investigate potential processing of immune-regulatory nucleotides

  • Cell Signaling Modulation:

    • Potential Role: By processing specific extracellular nucleotides, ENPP5 may influence purinergic signaling

    • Investigative Approaches:

      • Measure calcium signaling responses in cells with modified ENPP5 expression

      • Analyze receptor activation downstream of ENPP5 substrates

      • Perform phosphoproteomic analysis to identify affected signaling pathways

  • Tissue-Specific Functions:

    • Potential Role: Expression patterns may indicate tissue-specialized functions

    • Investigative Approaches:

      • Perform systematic expression analysis across tissues

      • Create tissue-specific conditional knockouts

      • Analyze phenotypic consequences in tissues with high ENPP5 expression

  • Pathological Implications:

    • Potential Role: Altered ENPP5 expression or function may contribute to disease states

    • Investigative Approaches:

      • Screen disease tissue banks for ENPP5 expression changes

      • Analyze GWAS data for ENPP5 associations with disease

      • Test disease progression in ENPP5-modified animal models

Experimental interrogation of these potential roles requires multidisciplinary approaches combining biochemical characterization, genetic manipulation, and physiological analysis in appropriate model systems.

What are the recommended storage and handling conditions for maintaining recombinant mouse ENPP5 activity?

Optimal storage and handling of recombinant mouse ENPP5 is critical for maintaining enzymatic activity. Based on established protocols for related ENPP family proteins, the following recommendations apply:

  • Short-term Storage (1-2 weeks):

    • Temperature: 4°C

    • Buffer Composition:

      • 25-50 mM Tris or HEPES buffer, pH 7.5-8.0

      • 100-150 mM NaCl

      • 10-50 μM ZnCl₂ to maintain zinc coordination

      • 5-10% glycerol as stabilizer

      • Optional: 0.02% sodium azide as preservative

  • Long-term Storage:

    • Temperature: -80°C in single-use aliquots

    • Cryoprotectants: 10-20% glycerol or 5% trehalose

    • Flash-freezing in liquid nitrogen recommended

    • Avoid repeated freeze-thaw cycles; each cycle typically reduces activity by 10-30%

  • Working Solution Preparation:

    • Thaw frozen aliquots rapidly at room temperature

    • Keep on ice after thawing

    • Dilute in assay buffer immediately before use

    • Discard unused diluted enzyme rather than refreezing

  • Critical Stability Factors:

    • Zinc Retention: Maintain 10-50 μM ZnCl₂ in all buffers to preserve the three essential zinc ions

    • pH Stability: Maintain pH between 7.5-8.0; activity rapidly decreases below pH 7.0

    • Protein Concentration: Higher concentrations (>0.5 mg/mL) generally improve stability

    • Avoiding Chelators: EDTA, EGTA, and other strong metal chelators should be strictly avoided

  • Stability Assessment:

    • Regularly test enzymatic activity using a consistent substrate

    • Establish activity half-life under various storage conditions

    • Consider using stability-indicating size exclusion chromatography to monitor aggregation

  • Transport Conditions:

    • Ship on dry ice for frozen samples

    • For short distances (<24 hours), shipping on wet ice is acceptable if protein includes stabilizers

Following these guidelines will help maintain recombinant mouse ENPP5 in its active form, ensuring reliable experimental results across extended research timelines.

How can researchers effectively validate ENPP5 knockdown or knockout models?

Comprehensive validation of ENPP5 knockdown or knockout models requires a multi-parameter approach to confirm both genetic modification and functional consequences:

  • Genetic Validation:

    • Genomic Analysis:

      • PCR genotyping with primers flanking the targeted region

      • Sequencing of the modified locus to confirm precise genetic changes

      • Assessment of potential off-target modifications in similar sequences

    • Transcript Analysis:

      • RT-qPCR to quantify ENPP5 mRNA levels

      • Northern blotting for transcript size verification

      • RNA-seq to detect potential alternative splicing or compensatory changes

  • Protein-level Validation:

    • Western Blotting:

      • Use validated antibodies against distinct ENPP5 epitopes

      • Include positive controls (recombinant ENPP5) and negative controls

      • Analyze multiple tissues/cell types where ENPP5 is normally expressed

    • Immunohistochemistry/Immunofluorescence:

      • Tissue section staining to confirm protein absence in knockout models

      • Compare subcellular localization patterns in partial knockdowns

      • Co-staining with cell type markers to assess cell-specific effects

  • Functional Validation:

    • Enzymatic Activity:

      • Measure phosphodiesterase activity using specific ENPP5 substrates

      • Analyze substrate accumulation (UDP-glucose, ADP-ribose)

      • Perform enzyme activity restoration with recombinant ENPP5 to confirm specificity

    • Metabolite Analysis:

      • Mass spectrometry to quantify ENPP5 substrate levels in biological samples

      • Untargeted metabolomics to identify broader metabolic consequences

      • Flux analysis with labeled substrates to track metabolic pathway alterations

  • Phenotypic Validation:

    • Systematic Phenotyping:

      • Comprehensive health screening of knockout animals

      • Targeted assessment of systems where ENPP5 is highly expressed

      • Challenge tests to reveal conditional phenotypes

    • Cellular Phenotypes:

      • Cell proliferation, migration, and morphology assessment

      • Response to extracellular nucleotides and nucleotide sugars

      • Cell-specific functional assays based on ENPP5 expression pattern

  • Rescue Experiments:

    • Reintroduction of wild-type ENPP5 to confirm phenotype reversibility

    • Structure-function analysis using mutant ENPP5 variants (e.g., catalytically inactive, Tyr73Phe)

    • Tissue-specific or inducible ENPP5 restoration

This comprehensive validation strategy ensures that observed phenotypes can be confidently attributed to ENPP5 deficiency rather than off-target effects or compensatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.