Recombinant Mouse EF-hand domain-containing family member A2 (Efha2)

Shipped with Ice Packs
In Stock

Description

Biological Function

Efha2 is essential for modulating mitochondrial calcium uptake:

Role in the MCU Complex

Efha2 interacts with the mitochondrial calcium uniporter (MCU) and other MICU family members (MICU1, MICU2) to regulate Ca²⁺ influx:

  • Gatekeeping Function: Acts as a low-Ca²⁺ sensor, preventing excessive mitochondrial Ca²⁺ overload .

  • Tissue-Specific Regulation: Expressed predominantly in the central nervous system, influencing mitochondrial Ca²⁺ dynamics in neurons .

Mechanism of Action

Efha2 binds Ca²⁺ via its EF-hand motifs, triggering structural rearrangements that modulate MCU channel activity. Unlike MICU1 and MICU2, which form heterodimers, Efha2’s specific role remains under investigation but is linked to fine-tuning Ca²⁺ uptake thresholds .

Recombinant Protein Production

Recombinant Efha2 is produced in E. coli for research applications:

ParameterSpecificationSource
Expression SystemE. coli
Purity>90% (SDS-PAGE)
StorageLyophilized powder; store at -20°C/-80°C
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with glycerol (5–50% for stability)
BufferTris/PBS-based, 6% trehalose, pH 8.0

Notes:

  • Avoid repeated freeze-thaw cycles to maintain activity.

  • Working aliquots should be stored at 4°C for ≤1 week .

Functional Studies

  • Calcium Binding: Efha2 binds Ca²⁺ with high specificity, as demonstrated by Ca²⁺ overlay assays and thermal stabilization studies .

  • Interaction with Calmodulin: Identified as a calmodulin-binding protein in high-throughput screens, suggesting roles in Ca²⁺-dependent signaling pathways .

Comparative Analysis with MICU1/MICU2

FeatureMICU1/MICU2MICU3 (Efha2)Source
LocalizationIntermembrane space (with MCU)Mitochondrial intermembrane space
OligomerizationHeterodimer (MICU1 + MICU2)Likely monomeric or distinct complex
Ca²⁺ SensitivityLow-threshold sensingPotential high-threshold sensing

Clinical and Experimental Relevance

Efha2’s role in mitochondrial Ca²⁺ regulation implicates it in:

  • Neurological Disorders: Dysregulated Ca²⁺ uptake may contribute to neurodegenerative diseases (e.g., Alzheimer’s) .

  • Cancer Research: MICU3 expression patterns in tumors are under investigation, with potential links to metastasis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Micu3; Efha2; Calcium uptake protein 3, mitochondrial; EF-hand domain-containing family member A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-523
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Micu3
Target Protein Sequence
MAALRRFLWPPPRLSPALAPQQPFLSPWGRPAGTAPGMSGRPFSCREEDEGAVAEAAWRR RRWGELSIAAAAGGGLVGLVCYQLYGDPRADPSELAAPELEDPPRGRGLLPIPVAAAKET VATGRAITEDLDLYATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKFAKTWKSLS KQELSQMLSETPPVWKGSSKLFRNLKERGVISYTEYLFLLCILTKPHAGFRIAFNMFDTD GNEMVDKKEFLVLQEIFRKKNEKRETKGDEEKRAMLRLQLYGYHSPTNSVLKTDAGELVS RSYWDTLRRSTSQALFSDLAERADDITSLVADTTLLVHFFGKKGKAELNFEDFYRFMDNL QTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSISEEKGITFDEFR SFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKLSPHLVNTVFKIFDVDKD DQLSYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR
Uniprot No.

Target Background

Function
May play a role in mitochondrial calcium uptake.
Gene References Into Functions
  1. MICU3 is a tissue-specific enhancer of mitochondrial calcium uptake. PMID: 29725115
Database Links
Protein Families
MICU1 family, MICU3 subfamily
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.
Tissue Specificity
Predominantly expressed in skeletal muscle and central nervous system.

Q&A

What is Mouse EF-hand domain-containing family member A2 (Efha2) and what are its key identifiers?

Efha2, also known as MICU3 (Mitochondrial Calcium Uptake Protein 3), is a calcium-binding protein that plays a crucial role in mitochondrial calcium uptake regulation. It is prominently expressed in the brain and functions as an enhancer of MCU (Mitochondrial Calcium Uniporter)-dependent mitochondrial Ca²⁺ uptake .

IdentifiersInformation
UniProt IDQ9CTY5
SynonymsMICU3; Efha2; Calcium uptake protein 3, mitochondrial; EF-hand domain-containing family member A2
Gene NameMicu3
Protein LengthFull Length (1-523 amino acids)

The protein contains characteristic EF-hand motifs that are responsible for its calcium-binding capabilities . These structural elements are critical for its function in modulating calcium signaling within mitochondria.

What is the significance of the EF-hand domain in Efha2?

The EF-hand domain is a helix-loop-helix calcium-binding motif that represents one of the most common structural elements found in calcium-binding proteins . In Efha2/MICU3, these domains:

  • Function as calcium sensors that detect changes in cytosolic calcium concentration

  • Undergo conformational changes upon calcium binding

  • Mediate protein-protein interactions within the MCU complex

  • Contribute to the specificity of calcium-dependent signaling responses

The EF-hand domains in MICU proteins are particularly important as they allow for the sigmoidal response to calcium concentrations, which is critical for proper regulation of mitochondrial calcium uptake . This creates a threshold effect where minimal calcium enters the mitochondria at low cytosolic concentrations, but uptake increases exponentially when calcium exceeds certain levels.

What is the tissue distribution and expression pattern of Efha2?

Efha2/MICU3 displays a distinctive tissue-specific expression pattern:

  • It is highly expressed in the brain, particularly in neurons

  • Expression is significantly lower in non-neural tissues

  • Within neurons, it localizes primarily to presynaptic mitochondria

This restricted expression pattern suggests a specialized role in neuronal calcium signaling and energy metabolism. According to studies, MICU3 enables presynaptic mitochondria to take up calcium in response to small changes in cytosolic calcium concentration, thus supporting axonal ATP synthesis . This tissue-specific distribution makes it an important target for neuronal function studies.

How should recombinant Efha2 protein be properly reconstituted and stored for experimental use?

For optimal results when working with recombinant mouse Efha2 protein:

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) to improve stability

  • The default recommended final concentration of glycerol is 50%

Storage Recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 as storage buffer

Important Considerations:

  • Repeated freezing and thawing is not recommended as it may affect protein activity

  • For experiments requiring calcium binding activity, ensure proper calcium concentrations in your experimental buffers

What experimental approaches can be used to study the calcium-binding properties of Efha2?

Several methodological approaches can be employed to investigate the calcium-binding properties of Efha2:

Direct Structural Analysis:

  • Solution NMR spectroscopy is well-suited for defining conformational changes induced by calcium binding

  • X-ray crystallography to determine the three-dimensional structure of Efha2 in different calcium-bound states

Functional Assays:

  • Single-cell calcium imaging using fluorescent Ca²⁺ indicators (e.g., Fura-2/AM) to monitor calcium dynamics

  • FRET-based ER luminal Ca²⁺-sensitive probes (e.g., chameleon protein D1ER) to measure intracellular calcium levels

  • [³H]ryanodine binding assays to evaluate calcium-dependent activation

Protein Engineering Approaches:

  • Site-directed mutagenesis of EF-hand motifs to assess their contribution to calcium binding

  • Deletion of entire EF-hand domains to determine their role in calcium sensing

  • Creation of chimeric proteins to identify critical regions for specific functions

These approaches can provide complementary information about how Efha2 binds calcium and how this binding affects its function within the mitochondrial calcium uptake machinery.

How does Efha2/MICU3 functionally differ from other MICU family proteins in the MCU complex?

Efha2/MICU3 has several distinctive characteristics that differentiate it from other MICU family proteins:

FeatureMICU1MICU2MICU3 (Efha2)
ExpressionWidespreadWidespreadBrain-specific
FunctionGatekeeper, threshold setterNegative regulatorEnhancer of Ca²⁺ uptake
DimerizationForms heterodimers with MICU2 or MICU3Forms heterodimers with MICU1Forms disulfide bond-mediated dimers with MICU1 only
Effect on MCUSets threshold for activationInhibits MCU at low [Ca²⁺]Decreases threshold for MCU opening
Neuronal rolePresentLimitedAllows Ca²⁺ uptake during small cytosolic Ca²⁺ changes

MICU3 specifically allows presynaptic mitochondria to take up calcium in response to small changes in cytosolic calcium concentration, which is crucial for sustaining axonal ATP synthesis . This property makes it particularly important in neuronal function, where rapid and sensitive responses to calcium signals are required. The experimental approach to studying these differential functions often involves silencing specific MICU proteins in primary neuronal cultures and assessing the resulting changes in calcium dynamics .

What experimental design considerations are important when studying Efha2 in neuronal systems?

When designing experiments to investigate Efha2 function in neuronal systems, several key methodological considerations should be addressed:

Cell Model Selection:

  • Primary cortical neurons provide a physiologically relevant system for studying Efha2's neuronal functions

  • HEK293 cell lines expressing Efha2 can serve as a controlled system for specific mechanistic studies

Genetic Manipulation Approaches:

  • RNA interference (siRNA) to silence Efha2 expression

  • CRISPR-Cas9 gene editing for complete knockout studies

  • Overexpression systems to assess gain-of-function effects

Functional Readouts:

  • Mitochondrial calcium measurements using targeted calcium indicators

  • Assessment of synaptic activity-induced calcium signals

  • Evaluation of axonal ATP production in response to neuronal stimulation

Experimental Controls:

  • Include wild-type controls alongside genetic manipulations

  • Use other MICU family proteins (MICU1, MICU2) as comparative controls

  • Implement rescue experiments to confirm specificity of observed effects

Calcium Challenge Paradigms:

  • Evaluate responses to different calcium concentrations (0.1 to 2.0 mM)

  • Assess effects of store Ca²⁺ overload in SOICR (Store Overload-Induced Ca²⁺ Release) experiments

  • Monitor responses to synaptic stimulation protocols specific to neuronal function

These methodological considerations ensure robust experimental design that can effectively isolate and characterize the specific contributions of Efha2 to neuronal calcium signaling and energy metabolism.

How can researchers determine if mutations in EF-hand motifs affect the calcium-sensing function of Efha2?

To investigate how mutations in EF-hand motifs impact the calcium-sensing function of Efha2, researchers can employ a systematic experimental approach:

Site-Directed Mutagenesis Strategy:

  • Target conserved residues within the EF-hand motifs that coordinate calcium binding

  • Generate individual point mutations in each EF-hand (EF1, EF2) separately

  • Create combined mutations across multiple EF-hands

  • Develop complete deletion constructs of entire EF-hand domains

Functional Assessment Methods:

  • Single-cell calcium imaging to measure mitochondrial calcium uptake in response to increasing extracellular calcium concentrations

  • Patch-clamp electrophysiology to directly measure calcium currents through the MCU complex

  • FRET-based assays to detect conformational changes in response to calcium binding

  • Evaluation of protein-protein interactions with other MCU complex components

Data Analysis Approach:

  • Compare activation and termination thresholds for calcium uptake between wild-type and mutant proteins

  • Analyze dose-response curves to detect shifts in calcium sensitivity

  • Determine cooperativity coefficients to assess changes in calcium-binding properties

What are the current technical challenges in studying Efha2's role in mitochondrial calcium regulation?

Several significant technical challenges exist in the study of Efha2/MICU3 function:

Protein Purification and Stability Issues:

  • The recombinant protein requires specific buffer conditions and storage parameters

  • Maintaining proper folding and calcium-binding activity in vitro can be difficult

  • Producing sufficient quantities of functional protein for structural studies presents challenges

Limitations in Measuring Rapid Calcium Dynamics:

  • The fast kinetics of mitochondrial calcium uptake require high temporal resolution measurement techniques

  • Distinguishing between cytosolic and mitochondrial calcium pools demands specialized probes and imaging approaches

  • Correlating calcium dynamics with functional outcomes requires multiparameter measurements

Tissue-Specific Expression Challenges:

  • The predominantly neuronal expression of Efha2 limits the use of many standard cell lines

  • Primary neuronal cultures exhibit variability in expression levels and functional properties

  • In vivo studies face challenges in specifically targeting neuronal Efha2 without affecting other calcium regulatory mechanisms

Complexity of the MCU Complex:

  • Efha2 functions as part of a multimolecular complex with other interacting proteins

  • Isolating the specific contribution of Efha2 requires sophisticated genetic and biochemical approaches

  • Reconstituting the complete functional complex in vitro presents significant technical hurdles

Addressing these challenges requires integrated methodological approaches combining genetic, biochemical, structural, and functional techniques to fully understand the role of Efha2 in mitochondrial calcium regulation.

How can experimental design address the tissue-specific functions of Efha2 in neuronal calcium signaling?

To effectively investigate the tissue-specific functions of Efha2 in neuronal calcium signaling, researchers should implement a comprehensive experimental design that accounts for the unique neuronal context:

Model System Selection and Validation:

  • Utilize primary cortical neurons as they naturally express MICU3/Efha2 at high levels

  • Consider region-specific neuronal populations to account for potential functional variations

  • Validate expression patterns of Efha2 in your specific model system before functional studies

Comparative Experimental Framework:

  • Compare neuronal responses to non-neuronal cells expressing equivalent levels of Efha2

  • Examine responses in neurons from different brain regions with varying Efha2 expression

  • Include developmental time points to assess age-dependent changes in Efha2 function

Functional Assessment in Neuronal Context:

  • Evaluate calcium dynamics during physiologically relevant neuronal activities (e.g., synaptic transmission)

  • Assess the impact of Efha2 manipulation on neuron-specific processes like neurotransmitter release

  • Monitor mitochondrial function at synaptic terminals where Efha2 plays a critical role

Integration with Other Neuronal Calcium-Handling Mechanisms:

  • Examine interactions with neuronal calcium channels and transporters

  • Investigate cross-talk with endoplasmic reticulum calcium stores in neurons

  • Assess impacts on calcium-dependent neuronal signaling pathways

By implementing this experimental design framework, researchers can more effectively isolate and characterize the neuron-specific functions of Efha2 in calcium signaling and mitochondrial calcium regulation while controlling for potential confounding variables.

What controls are essential when studying Efha2 in calcium uptake experiments?

When designing experiments to study Efha2's role in calcium uptake, several critical controls must be included to ensure valid and interpretable results:

Genetic Controls:

  • Wild-type samples expressing endogenous levels of Efha2

  • Complete knockout/knockdown of Efha2 to establish baseline responses

  • Rescue experiments with re-expression of wild-type Efha2 to confirm specificity

  • Expression of other MICU family proteins (MICU1, MICU2) for comparison

Biochemical Controls:

  • Calcium-free conditions to establish baseline measurements

  • Calcium chelators (EGTA, BAPTA) to confirm calcium dependency

  • Specific MCU inhibitors (Ru360) to confirm channeling through the uniporter complex

  • Mitochondrial uncouplers (FCCP) to dissipate membrane potential and block calcium uptake

Expression Level Controls:

  • Verification of protein expression levels via Western blot or immunofluorescence

  • Titration of expression levels to avoid artifacts from overexpression

  • Time-course analyses to account for dynamic changes in expression

Technical Controls:

  • Non-specific IgG controls for immunoprecipitation experiments

  • Loading controls for mitochondrial content in functional assays

  • Vehicle controls for any pharmacological treatments

  • Mock transfection/transduction controls for genetic manipulation approaches

Implementing these comprehensive controls ensures that observed effects can be specifically attributed to Efha2 function and provides the necessary framework for rigorous interpretation of experimental results.

How can researchers effectively design experiments to investigate Efha2's interaction with the MCU complex?

To effectively study how Efha2 interacts with the MCU complex, researchers should employ a multi-faceted experimental design approach:

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation assays to identify direct binding partners

  • Proximity ligation assays to detect in situ protein interactions

  • FRET or BRET approaches to measure real-time interactions in living cells

  • Cross-linking mass spectrometry to map interaction interfaces at the molecular level

Structure-Function Analysis:

  • Domain mapping through truncation mutants to identify interaction regions

  • Site-directed mutagenesis of key residues that may mediate interactions

  • Disulfide bond formation analysis to assess dimerization with MICU1

  • Competition assays with other MICU proteins to determine binding preferences

Functional Reconstitution Approaches:

  • Stepwise reconstitution of the MCU complex with defined components

  • Electrophysiological measurements of reconstituted channels in planar lipid bilayers

  • Calcium uptake assays with purified mitochondria from cells expressing defined components

  • In vitro binding assays with purified recombinant proteins

Dynamic Regulation Assessment:

  • Analysis of complex formation under different calcium concentrations

  • Evaluation of post-translational modifications affecting interactions

  • Investigation of calcium-dependent conformational changes using structural techniques

  • Time-resolved studies to capture the kinetics of complex assembly and disassembly

This comprehensive experimental design strategy allows researchers to systematically investigate the molecular determinants, dynamics, and functional consequences of Efha2's interactions with the MCU complex, providing insights into its specific role within the mitochondrial calcium uptake machinery.

What experimental design approaches are most effective for studying the impact of Efha2 on mitochondrial function?

To comprehensively assess how Efha2 influences mitochondrial function, researchers should implement integrated experimental design approaches:

Mitochondrial Calcium Measurement Techniques:

  • Targeted genetically encoded calcium indicators (e.g., mito-GCaMP) for real-time monitoring

  • Calcium-sensitive fluorescent dyes with mitochondrial localization

  • Direct calcium measurements in isolated mitochondria using calcium-sensitive electrodes or fluorescent indicators

  • Patch-clamp electrophysiology of mitoplasts to directly measure calcium currents

Mitochondrial Bioenergetic Assessments:

  • Oxygen consumption measurements to evaluate respiratory capacity

  • ATP production assays to assess energy metabolism

  • Membrane potential measurements using potentiometric dyes

  • Metabolic flux analysis to characterize substrate utilization patterns

Integration with Cellular Physiology:

  • Correlation of calcium transients with functional outputs (e.g., ATP production)

  • Assessment of mitochondrial responses to physiological stimuli

  • Evaluation of cell type-specific functions (e.g., neurotransmitter release in neurons)

  • Analysis of calcium-dependent enzyme activities (e.g., TCA cycle dehydrogenases)

Genetic Manipulation Strategies:

  • Generate cells with specific Efha2 mutations:

    • EF-hand mutations to alter calcium sensing

    • Interaction domain mutations to disrupt MCU complex formation

    • Expression level modulations via inducible systems

  • Implement rescue experiments with wild-type and mutant constructs

  • Utilize acute manipulations (e.g., optogenetic tools) to assess immediate effects

These integrated approaches enable researchers to connect Efha2's molecular functions to broader mitochondrial physiology and cellular outcomes, providing a comprehensive understanding of its role in mitochondrial biology.

What are the emerging research questions regarding Efha2's role in neuronal function and pathology?

Several key research questions are currently emerging in the field of Efha2/MICU3 research:

  • How does Efha2 contribute to the specialized calcium handling requirements of different neuronal subtypes?

  • What is the role of Efha2 in neurodegenerative conditions where mitochondrial calcium dysregulation is implicated?

  • How does Efha2 function change during neuronal development, aging, or in response to neuronal activity?

  • Can modulation of Efha2 function provide neuroprotection in conditions of excitotoxicity or metabolic stress?

  • What is the relationship between Efha2-mediated calcium regulation and synaptic plasticity mechanisms?

  • How do Efha2 variants or mutations contribute to neurological disorders?

  • What is the structural basis for the neuron-specific functions of Efha2 compared to other MICU proteins?

Addressing these questions will require integrated approaches combining structural biology, electrophysiology, advanced imaging, and in vivo models to fully elucidate the complex roles of Efha2 in neuronal physiology and pathology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.