Recombinant Mouse EGF-like module-containing mucin-like hormone receptor-like 4 (Emr4)

Shipped with Ice Packs
In Stock

Description

Introduction to Mouse Emr4

Emr4, also known as adhesion G protein-coupled receptor E4 (Adgre4), belongs to the epidermal growth factor-seven transmembrane (EGF-TM7) family of receptors. This family comprises several members including mouse F4/80 (Emr1), human EGF module-containing mucin-like hormone receptor 1 (EMR1), human EMR2, and human and mouse CD97 . These molecules are characterized by their unique hybrid structure, combining extracellular EGF-like domains with a seven-span transmembrane region connected by a mucin-like stalk . Mouse Emr4 has been identified as the first EGF-TM7 receptor known to facilitate cellular interactions between myeloid cells and B cells, highlighting its significance in immune system communication .

Genetic Information and Chromosomal Localization

The genetic context of Emr4 provides important insights into its evolutionary relationships and potential functional overlap with related proteins. Through precise genetic mapping, researchers have established that mouse Emr4 (Adgre4) is localized in the distal region of mouse chromosome 17, positioned in close proximity to another EGF-TM7 gene, F4/80 (Emr1) . This gene clustering suggests a potential evolutionary relationship and possible functional redundancy among the EGF-TM7 family members.

The gene encoding mouse Emr4 is capable of generating protein isoforms through alternative splicing, a characteristic shared with other EGF-TM7 family members . This splicing diversity may contribute to functional variability across different cell types and physiological contexts, allowing for fine-tuned regulation of Emr4-mediated cellular responses.

Expression Pattern in Different Cell Types

Mouse Emr4 displays a predominantly leukocyte-restricted expression pattern, with significant cell-type specificity that suggests specialized immunological functions. Understanding this expression profile is essential for interpreting the biological significance of Emr4 in various immune contexts.

Cell-Type Specific Expression

The expression pattern of mouse Emr4 across different immune cell populations shows notable specificity:

Cell TypeExpression LevelNotes
Resident macrophagesHighPredominant expression site
Thioglycollate-elicited peritoneal neutrophilsLowDetectable but limited expression
Bone marrow-derived dendritic cellsLowDetectable but limited expression
MonocytesVariableExpression detected in some studies
B lymphocytesNot reportedServes as ligand target rather than expressing Emr4

Regulation of Expression

The expression of mouse Emr4 is dynamically regulated by various inflammatory and immunomodulatory signals:

  1. Up-regulated following macrophage activation in Biogel and thioglycollate-elicited peritoneal macrophages

  2. Over-expressed in TNF-alpha-treated resident peritoneal macrophages

  3. Significantly down-regulated by interleukin-4 and interleukin-10 treatment

These expression patterns suggest that Emr4 may play a role in inflammatory responses, with increased expression during pro-inflammatory conditions and decreased expression during resolution and anti-inflammatory states.

Functional Aspects of Mouse Emr4

Mouse Emr4 demonstrates several specialized functional properties that contribute to its role in immune system communication and regulation. Its unique molecular mechanisms and cellular interactions suggest important immunological functions.

Proteolytic Processing

A distinctive feature of mouse Emr4 is its post-translational processing. Research has demonstrated that Emr4 undergoes proteolytic cleavage within the extracellular stalk region, resulting in two protein subunits that remain associated noncovalently as a heterodimer . This proteolytic processing site has been identified through N-terminal amino acid sequencing and is located at the conserved G protein-coupled receptor (GPCR) proteolytic site in the extracellular region . This processing may represent an important regulatory mechanism affecting receptor function and cell surface presentation.

Ligand Interactions

Mouse Emr4 functions as a cell-surface receptor that recognizes specific binding partners. Using multivalent biotinylated mEMR4-mFc fusion proteins as experimental probes, researchers have identified a putative cell surface ligand on the B lymphoma cell line A20 through cell-binding assays . The interaction between mouse Emr4 and its ligand shows several distinct characteristics:

  1. The binding is calcium-independent, unlike some other cell adhesion molecules that require calcium for function

  2. The interaction is mediated predominantly by the second EGF-like module of Emr4

  3. The binding appears to be specific to B lymphocytes, suggesting a role in myeloid-B cell communication

These findings position mouse Emr4 as the first EGF-TM7 receptor known to mediate cellular interactions between myeloid cells and B cells, highlighting its potential importance in coordinating innate and adaptive immune responses .

Recombinant Emr4 Production and Characteristics

The production of recombinant mouse Emr4 has been instrumental in advancing research on this protein's structure and function. Various expression systems and purification strategies have been employed to generate research-grade recombinant protein.

Production Methods

Recombinant full-length mouse Emr4 protein is typically produced using bacterial expression systems, particularly Escherichia coli . The recombinant protein generally includes the mature protein sequence (amino acids 38-689) fused to an N-terminal histidine tag to facilitate purification . This expression strategy enables the production of sufficient quantities of protein for structural studies, functional assays, and antibody generation.

Physical and Biochemical Properties

The recombinant mouse Emr4 protein exhibits specific physical and biochemical characteristics relevant to its storage and experimental use:

PropertyDescription
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C upon receipt, with aliquoting necessary for multiple use
ReconstitutionRecommended in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage

These characteristics are critical considerations for researchers working with recombinant Emr4, as proper handling and storage are essential for maintaining protein activity and experimental reproducibility.

Research Applications and Available Tools

Various research tools have been developed to facilitate the study of mouse Emr4, enabling investigations into its expression, localization, and function. These resources are valuable for researchers seeking to understand the biological roles of this protein.

Several molecular resources are available for Emr4 research:

  1. Mouse EMR4 (NP_631877) VersaClone cDNA: Contains the complete open reading frame for EMR4, with convenient multiple cloning sites for transfer to expression vectors

  2. Transcript analysis tools: Northern blotting and RT-PCR methods have been established for analyzing Emr4 expression

These tools enable diverse experimental approaches to investigate Emr4's expression, regulation, and function across different biological contexts.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice packaging, please contact us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
Adgre4; Emr4; Adhesion G protein-coupled receptor E4; EGF-like module receptor 4; EGF-like module-containing mucin-like hormone receptor-like 4; F4/80-like-receptor; Seven-span membrane protein FIRE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
38-689
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Adgre4
Target Protein Sequence
CPQCNENASCFNSTHCVCKEGFWTGSENRRIIEPHEKCQDINECLLKELVCKDVSYCRNK IGTYICSCVVKYPLFNWVAGIINIDHPDCYVNKSKNTGSKTHTLGVLSEFKSKEEVAKGA TKLLRKVEHHILNENSDIPKKDENPLLDIVYETKRCKTMTLLEAGNNTMKVDCTSGFKEH NSGGETAVAFIAYKSLGNLLNGSFFSNEEGFQEVTLNSHIVSGAIRSEVKPVLSEPVLLT LQNIQPIDSRAEHLCVHWEGSEEGGSWSTKGCSHVYTNNSYTICKCFHLSSFAVLMALPH EEDGVLSALSVITYVGLSLSLLCLFLAAITFLLCRPIQNTSTTLHLQLSICLFLADLLFL TGINRTKPKVLCSIIAGMLHYLYLASFMWMFLEGLHLFLTVSNLKVANYSNSGRFKKRFM YPVGYGLPAFIVAVSAIAGHKNYGTHNHCWLSLHRGFIWSFLGPAAAIILINLVFYFLII WILRSKLSSLNKEVSTLQDTKVMTFKAIVQLFVLGCSWGIGLFIFIEVGKTVRLIVAYLF TIINVLQGVLIFMVHCLLNRQVRMEYKKWFHRLRKEVESESTEVSHSTTHTKMGLSLNLE NFCPTGNLHDPSDSILPSTEVAGVYLSTPRSHMGAEDVNSGTHAYWSRTISD
Uniprot No.

Target Background

Function
Emr4 (EGF-like module-containing mucin-like hormone receptor-like 4) may mediate the cellular interaction between myeloid cells and B-cells.
Gene References Into Functions
  1. Emr4 is the first EGF-TM7 receptor known to mediate the cellular interaction between myeloid cells and B cells. PMID: 12023293
  2. Emr4 is activated in mucosal and cutaneous wounds. PMID: 12709506
  3. Two alternatively spliced human FIRE transcripts have been identified, neither of which are predicted to express the TM7 cassette. Therefore, if the human FIRE exists, it is likely expressed as a soluble secreted molecule. PMID: 16753812
Database Links
Protein Families
G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in myeloid cells. Predominantly expressed on resident macrophages.

Q&A

Basic Research Information

  • What is the molecular structure of mouse Emr4 and how does it differ from other EGF-TM7 family members?

Mouse Emr4 is a member of the EGF-TM7 family of adhesion-type class B 7-transmembrane receptors. The full-length mouse EMR4 cDNA encodes a predicted 689-amino acid protein with a distinctive structure including:

  • Two epidermal growth factor (EGF)-like modules in the N-terminal region

  • A mucin-like spacer domain

  • A seven-transmembrane domain with a cytoplasmic tail

Unlike human EMR2 which contains five EGF-like domains, mouse EMR4 contains only two EGF-like modules . The protein undergoes proteolytic processing within the extracellular stalk region at the conserved G protein-coupled receptor (GPCR) proteolytic site, resulting in two protein subunits that remain associated noncovalently as a heterodimer .

Genetic mapping has established that mouse EMR4 is localized in the distal region of mouse chromosome 17 in close proximity to another EGF-TM7 gene, F4/80 (Emr1) .

  • What is the expression pattern of Emr4 in mouse tissues and cell types?

Mouse EMR4 displays a predominantly leukocyte-restricted expression pattern, with significant cell-type specificity:

Cell TypeExpression LevelRegulation
Resident macrophagesHighPrimary expression site
Thioglycollate-elicited peritoneal neutrophilsLowLimited expression
Bone marrow-derived dendritic cellsLowLimited expression
Peripheral T and B lymphocytesNot detectedAbsence of expression
Thioglycollate-elicited peritoneal macrophagesDown-regulatedReduced expression compared to resident macrophages

EMR4 expression is dynamically regulated during immune responses. It is up-regulated following macrophage activation in Biogel and thioglycollate-elicited peritoneal macrophages, as well as in TNF-α-treated resident peritoneal macrophages. Conversely, interleukin-4 and interleukin-10 dramatically reduce EMR4 expression .

Experimental Applications

  • What are the recommended methods for expression and purification of recombinant mouse Emr4?

Recombinant mouse EMR4 can be successfully produced using several expression systems. Based on research protocols, the following methodological approach is recommended:

Bacterial Expression System:

  • Construct a prokaryotic expression plasmid (e.g., pET28a/mEMR4) with a C-terminal His-tag

  • Express in E. coli under optimal induction conditions

  • Purify via nickel affinity chromatography

  • Renature with GSH/GSSG system to ensure proper folding

Insect Cell Expression System:
For studies requiring post-translational modifications:

  • Design a plasmid using state-of-the-art algorithm for gene synthesis

  • Express in insect cells to allow for glycosylation and proper folding

  • Purify using a multi-step, protein-specific process to ensure crystallization grade quality

Quality Control Parameters:

  • Verify protein identity by SDS-PAGE and Western blot with anti-EMR4 antibodies

  • Confirm purity (≥95%) using SDS-PAGE and SEC-HPLC

  • Test for endotoxin levels (should be ≤0.1 ng per μg of protein)

  • Validate biological activity through appropriate functional assays

  • How can researchers design experimental studies to investigate Emr4 function in macrophage biology?

Designing robust experiments to study Emr4 function requires careful consideration of several methodological approaches:

Experimental Design Considerations:

  • Variable Selection:

    • Independent variables: EMR4 expression levels, activation status of macrophages, cytokine treatments

    • Dependent variables: Cell migration, adhesion, cytokine production, interaction with B cells

    • Control variables: Cell culture conditions, genetic background of mice

  • Knockout/Knockdown Approaches:

    • Generate EMR4-deficient macrophages using CRISPR-Cas9 or siRNA techniques

    • Compare functional outcomes between wild-type and EMR4-deficient cells

    • Complement with rescue experiments using recombinant EMR4

  • Ligand Interaction Studies:

    • Use multivalent biotinylated EMR4-Fc fusion proteins as probes

    • Employ cell-binding assays to identify cellular ligands (e.g., on B lymphoma cell line A20)

    • Conduct Ca²⁺-dependency tests to characterize binding properties

Readout Methodologies:

  • Flow cytometry to quantify EMR4 expression and binding to potential ligands

  • Migration and adhesion assays to assess functional outcomes

  • Cytokine production measurement to evaluate immunomodulatory effects

  • What are the critical factors to consider when using recombinant Emr4 in immunological assays?

When using recombinant Emr4 in immunological assays, researchers should consider several critical factors:

Storage and Handling:

  • Upon initial thawing, aliquot into polypropylene microtubes and freeze at -80°C

  • For in vitro biological assays, dilute in sterile neutral buffer containing 1-2 mg/mL carrier protein

  • For ELISA standards, use carrier protein concentrations of 5-10 mg/mL

  • Avoid repeated freeze-thaw cycles to prevent loss of activity

Assay Optimization:

  • For cell binding studies:

    • Add carrier proteins like mouse serum albumin (1-2 mg/mL) to prevent non-specific binding

    • Include appropriate negative controls (e.g., irrelevant recombinant proteins of similar size)

    • Consider using Mouse BD Fc Block™ to prevent Fc receptor-mediated binding

  • For functional assays:

    • Determine optimal concentration range through dose-response experiments

    • Include positive controls (e.g., known activators of target cells)

    • Account for potential endotoxin contamination by using endotoxin-free reagents

Advanced Research Questions

  • How does the proteolytic processing of Emr4 affect its function, and what techniques can be used to study this phenomenon?

Emr4 undergoes proteolytic processing at the GPCR proteolytic site in the extracellular region, resulting in a heterodimeric structure. This processing is critical for function and can be studied through various approaches:

Impact of Proteolytic Processing:

  • Creates two protein subunits that remain non-covalently associated

  • May regulate receptor activation and signaling

  • Potentially controls interaction with ligands on B lymphocytes

Methodological Approaches to Study Processing:

  • Site-directed mutagenesis:

    • Mutate the identified cleavage site to generate processing-deficient variants

    • Compare biological activities of wild-type and mutant proteins

    • Assess impact on cellular localization and ligand binding

  • Biochemical characterization:

    • Use N-terminal amino acid sequencing to precisely identify cleavage sites

    • Apply protease inhibitors to assess the role of specific proteases

    • Employ mass spectrometry to characterize processed forms

  • Imaging techniques:

    • Use fluorescently tagged Emr4 variants to track processing in living cells

    • Apply FRET-based approaches to monitor conformational changes upon processing

    • Implement super-resolution microscopy to visualize receptor distribution

  • What are the known ligand interactions of mouse Emr4, and how do they compare with other EGF-TM7 family members?

Mouse Emr4 has been shown to interact with specific cellular ligands, with distinct characteristics compared to other family members:

Ligand Characteristics:

  • A putative cell surface ligand has been identified on the B lymphoma cell line A20

  • The Emr4-ligand interaction is Ca²⁺-independent

  • This interaction is mediated predominantly by the second EGF-like module

Comparison with Other EGF-TM7 Members:

EGF-TM7 MemberKnown LigandsBinding PropertiesCellular Distribution
Mouse Emr4Ligand on B lymphoma cell line A20Ca²⁺-independentMyeloid cells, primarily macrophages
Human EMR2Chondroitin sulfate (CS)Ca²⁺-dependent (requires EGF4)Myeloid cells only
CD97CD55 (DAF), chondroitin sulfateVaries by isoformBroader expression pattern

Methodological Approaches for Ligand Studies:

  • Use recombinant soluble EMR4 multivalent probes to detect ligands on different cell types

  • Apply blocking antibodies to verify specificity of interactions

  • Conduct domain-swap experiments to identify critical binding regions

  • Implement surface plasmon resonance to quantify binding kinetics

  • What are the contradictions and knowledge gaps in current Emr4 research, and how might they be addressed?

Several contradictions and knowledge gaps exist in the current understanding of Emr4:

Contradictions:

  • Expression pattern discrepancies:

    • Some studies report expression restricted to resident macrophages

    • Others detect expression in neutrophils and dendritic cells

    • Resolution approach: Single-cell RNA sequencing to definitively map expression across immune cell populations

  • Functional significance:

    • Limited evidence for physiological relevance of Emr4-mediated interactions

    • Unclear how Emr4 contributes to macrophage function in vivo

    • Resolution approach: Generate tissue-specific conditional knockout mice to study function in different contexts

Knowledge Gaps:

  • Signaling pathways:

    • Limited understanding of downstream signaling cascades

    • Unknown G-protein coupling preferences

    • Research approach: Phosphoproteomic analysis following receptor activation

  • Evolution and conservation:

    • Relationship between mouse Emr4 and human EMR family members not fully characterized

    • Research approach: Comparative genomic and structural studies across species

  • Disease relevance:

    • Potential roles in inflammatory or immune disorders unexplored

    • Research approach: Analysis of Emr4 expression and function in disease models

Practical Applications

  • How can recombinant Emr4 be effectively used in immunological research beyond binding studies?

Recombinant Emr4 can serve multiple purposes in immunological research:

Therapeutic Potential Assessment:

  • Use as a competitive inhibitor of native Emr4-ligand interactions

  • Evaluate effects on macrophage-B cell communication

  • Assess impact on inflammatory responses in ex vivo tissue cultures

Antibody Generation:

  • Immunize with recombinant protein to generate monoclonal antibodies

  • Validate antibodies using flow cytometry, Western blotting, and immunoprecipitation

  • Apply antibodies to study endogenous Emr4 expression and function

Co-culture Systems:

  • Develop in vitro systems to study Emr4-mediated cellular interactions

  • Use recombinant protein to block interactions and assess functional consequences

  • Implement time-lapse microscopy to visualize dynamic cellular interactions

  • What experimental strategies can researchers employ to study the role of Emr4 in macrophage activation and polarization?

To investigate Emr4's role in macrophage activation and polarization, researchers can implement several experimental strategies:

In Vitro Approaches:

  • Stimulation Experiments:

    • Treat macrophages with various polarizing stimuli (M1: IFN-γ, LPS; M2: IL-4, IL-10)

    • Measure changes in Emr4 expression by flow cytometry and qRT-PCR

    • Correlate Emr4 levels with polarization markers

  • Gain/Loss of Function Studies:

    • Overexpress or silence Emr4 in macrophage cell lines

    • Assess impact on polarization marker expression

    • Evaluate functional consequences (phagocytosis, cytokine production)

Ex Vivo Approaches:

  • Primary Cell Isolation:

    • Isolate macrophages from different tissues of wild-type and Emr4-deficient mice

    • Compare polarization potential and responses to stimuli

    • Analyze transcriptional profiles by RNA sequencing

  • Co-culture Systems:

    • Establish co-cultures of macrophages with B cells

    • Block Emr4-ligand interactions using recombinant proteins or antibodies

    • Assess impact on macrophage polarization and B cell responses

Data Analysis Frameworks:

  • Apply multivariate analysis to identify correlations between Emr4 expression and polarization markers

  • Use principal component analysis to visualize macrophage polarization states

  • Implement machine learning approaches to predict Emr4 function based on expression patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.