Recombinant Mouse Elongation of very long chain fatty acids protein 2 (Elovl2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will do our best to fulfill your requirement.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Elovl2; Ssc2; Elongation of very long chain fatty acids protein 2; 3-keto acyl-CoA synthase Elovl2; ELOVL fatty acid elongase 2; ELOVL FA elongase 2; Very long chain 3-ketoacyl-CoA synthase 2; Very long chain 3-oxoacyl-CoA synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Elovl2
Target Protein Sequence
MEQLKAFDNEVNAFLDNMFGPRDSRVRGWFLLDSYLPTFILTITYLLSIWLGNKYMKNRP ALSLRGILTLYNLAITLLSAYMLVELILSSWEGGYNLQCQNLDSAGEGDVRVAKVLWWYY FSKLVEFLDTIFFVLRKKTNQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIH ILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTLSAVVKPCGFPFGCLIFQSS YMMTLVILFLNFYIQTYRKKPVKKELQEKEVKNGFPKAHLIVANGMTDKKAQ
Uniprot No.

Target Background

Function
Elovl2 is a crucial enzyme involved in the elongation of very long chain fatty acids (VLCFAs). It catalyzes the initial and rate-limiting step in the four-step VLCFA elongation cycle. This endoplasmic reticulum-bound process allows the addition of two carbon units to the chain of long- and very long-chain fatty acids per cycle. As a condensing enzyme, Elovl2 plays a critical role in the synthesis of polyunsaturated VLCFAs, specifically those with 20 and 22 carbons (C20- and C22-PUFA). It exhibits higher activity toward C20:4(n-6) acyl-CoA. Elovl2 participates in the production of VLCFAs of varying chain lengths, essential for various biological functions, including serving as precursors for membrane lipids and lipid mediators. Notably, Elovl2 is essential for the formation of C24:5(n-6) to C30:5(n-6) PUFAs in the testes, crucial for normal spermatogenesis and fertility.
Gene References Into Functions
  1. Network-based analysis suggests a role for Elovl2 in glucose-induced insulin secretion. Silencing Elovl2 decreased glucose-stimulated insulin secretion in mouse and human beta cell lines. PMID: 28377873
  2. The proportion of DHA in the liver and serum of Elovl2(-/-) offspring was significantly lower than in the Elovl2(+/+) offspring. Importantly, the DHA level in the Elovl2(+/-) offspring nurtured by DHA-free-fed Elovl2(-/-) mothers was nearly as high as in +/+ pups born to +/+ mothers. This observation suggests that endogenous synthesis in the offspring can compensate for maternal DHA deficiency. PMID: 27864326
  3. Liver docosahexanoic acid synthesis (via ELOVL2), alongside controlling de novo lipogenesis, also regulates lipid storage and fat mass expansion in a manner independent of SREBP-1c. PMID: 24489111
  4. Heterozygous Elovl2(+/-) male mice exhibited haploinsufficiency, characterized by reduced levels of C28:5 and C30:5n-6 PUFAs, leading to impaired formation and function of haploid spermatides. PMID: 21106902
  5. Overexpression of ELOVL2 enhances triacylglycerol synthesis in 3T3-L1 and F442A cells. PMID: 17583696

Show More

Hide All

Database Links

KEGG: mmu:54326

STRING: 10090.ENSMUSP00000021793

UniGene: Mm.2567

Protein Families
ELO family, ELOVL2 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in testis, lower level in liver. Weakly expressed in white adipose tissue, brain and kidney.

Q&A

What is Elovl2 and what is its primary biological function?

Elovl2 (elongation of very-long-chain fatty acids-like 2) is a transmembrane protein that catalyzes a rate-limiting step in the elongation of long-chain (C22 and C24) omega-3 and omega-6 polyunsaturated fatty acids (LC-PUFAs) . Its specific enzymatic activity enables the conversion of docosapentaenoic acid (DPA) (22:5n-3) to 24:5n-3, which can subsequently lead to the formation of very-long-chain PUFAs (VLC-PUFAs) as well as docosahexaenoic acid (DHA; 22:6n-3) . This elongation process is critical for maintaining adequate levels of these essential fatty acids in various tissues, particularly in the retina where DHA is the predominant polyunsaturated fatty acid. The biological significance of Elovl2 extends beyond simple lipid metabolism, as it has been implicated in age-related processes and protection against oxidative stress in photoreceptors.

In which mouse tissues is Elovl2 predominantly expressed?

Elovl2 expression has been detected in multiple mouse tissues, with particularly notable expression in the retina and liver. Within the retina, in situ hybridization with RNAscope probes has revealed that Elovl2 is predominantly expressed in the photoreceptor layer, particularly in cone cells, as well as in the retinal pigment epithelium (RPE) . The expression pattern is consistent across developmental stages but significantly decreases with age. In three-month-old mice, Elovl2 shows robust expression in these retinal layers, while in 22-month-old animals, the expression is dramatically reduced though still detectable in the same locations . Additionally, Elovl2 is highly expressed in the liver, where it also exhibits age-related decreases in expression correlating with increases in promoter methylation . The tissue-specific expression pattern suggests that Elovl2 may play distinct roles in different organs, with potentially unique age-related consequences in each tissue context.

How does the epigenetic regulation of Elovl2 change during aging?

The Elovl2 gene undergoes significant epigenetic changes during aging, particularly through increased DNA methylation of its promoter region. This age-associated hypermethylation correlates with decreased Elovl2 expression in multiple tissues . In mouse retina, this age-related methylation pattern is observed alongside declining Elovl2 mRNA levels, indicating that epigenetic regulation likely contributes to the reduced expression of this gene in aged tissues . This relationship between methylation and expression appears to be causative rather than merely correlative, as demonstrated by experiments using 5-Aza-2'-deoxycytidine (5-Aza-dc), a DNA methyltransferase inhibitor. Treatment with 5-Aza-dc leads to demethylation of the Elovl2 promoter and consequent increases in gene expression . Notably, Elovl2 methylation is considered one of the most robust biomarkers of human age, as it was the first gene shown to reliably exhibit increased methylation with advancing age in humans . This consistent epigenetic signature across species makes Elovl2 a valuable model for studying the molecular mechanisms underlying biological aging.

What experimental evidence supports Elovl2's role in regulating retinal aging?

Multiple lines of experimental evidence establish Elovl2 as a critical regulator of molecular aging in the retina. First, age-related methylation of the Elovl2 promoter region occurs in rodent retina and results in decreased expression of the gene with advancing age . Second, inhibition of Elovl2 expression through shRNA transfection in cell models increases senescence and decreases proliferation, both hallmarks of cellular aging . Conversely, administration of 5-Aza-dc, which demethylates the Elovl2 promoter, prevents these age-related cellular changes .

In vivo studies provide even more compelling evidence. Intravitreal injection of 5-Aza-dc in aged rodents increases Elovl2 expression and reverses age-related changes in visual function as measured by electroretinography (ERG) . Moreover, Elovl2 C234W mutant mice, which lack ELOVL2-specific enzymatic activity, display premature visual decline and accelerated appearance of autofluorescent deposits, both established markers of retinal aging . These mutant mice also develop sub-RPE deposits containing components found in human drusen, including complement component C3, C5b-9 membrane attack complex, HTRA1, oxidized lipids/T15, and ApoE . These drusen-like deposits are pathologic hallmarks of age-related macular degeneration (AMD), suggesting that Elovl2 dysfunction may accelerate processes involved in age-related eye diseases . Collectively, these findings demonstrate that Elovl2 plays a functional role in regulating age-associated phenotypes in the retina, linking polyunsaturated fatty acid metabolism to retinal aging and disease.

How can researchers generate and validate Elovl2 mutant models for aging studies?

Generating Elovl2 mutant models requires careful consideration of the protein's functional domains. Since complete Elovl2 knockout mice are infertile due to defects in spermatogenesis, alternative strategies targeting specific enzymatic functions are preferable . One successful approach utilized CRISPR-Cas9 technology to generate Elovl2-mutant mice encoding a cysteine-to-tryptophan substitution (C234W) . This specific mutation selectively inactivates the enzymatic activity required to process C22 PUFAs (converting docosapentaenoic acid to 24:5n-3) while retaining elongase activity for other substrates common to both ELOVL2 and its paralog ELOVL5 .

The methodology involves designing a single-guide RNA against the Elovl2 target region and a repair oligonucleotide with the desired mutation, followed by injection of these components along with Cas9 mRNA into mouse zygotes . Validation of correctly targeted founders requires comprehensive DNA sequencing to confirm the presence of the intended mutation and absence of off-target modifications .

Functional validation should include analysis of long-chain fatty acid levels in relevant tissues (such as retina) to confirm disruption of ELOVL2-specific activity . Additionally, phenotypic characterization through ERG for visual function, fundus photography for autofluorescent deposits, and immunohistological analysis for sub-RPE aggregates containing drusen components provides confirmation of the expected aging phenotype . This comprehensive approach ensures that the mutant model accurately reflects selective loss of ELOVL2 function and exhibits the anticipated accelerated aging phenotypes in the retina.

What molecular mechanisms link Elovl2 activity to retinal pathology and visual function?

The molecular pathways connecting Elovl2 activity to retinal function involve its essential role in polyunsaturated fatty acid (PUFA) metabolism. ELOVL2 specifically catalyzes the elongation of long-chain omega-3 and omega-6 PUFAs, which are critical components of photoreceptor outer segments . Among these, docosahexaenoic acid (DHA) is particularly important as the major PUFA in the retina, playing diverse roles in photoreceptor function, protection against oxidative stress, and retinal development .

When ELOVL2-specific activity is disrupted, as in the C234W mutant mice, alterations in PUFA composition likely impact membrane properties of photoreceptors and RPE cells . This disruption appears to trigger pathological processes including the formation of sub-RPE deposits containing complement components (C3, C5b-9), HTRA1, oxidized lipids, and ApoE – all components found in human drusen . The presence of these deposits suggests activation of inflammatory pathways, complement cascades, and lipid dysregulation, which are also implicated in age-related macular degeneration (AMD) .

The visual function decline observed in Elovl2 mutant mice, as measured by ERG, indicates that PUFA imbalances directly impact photoreceptor signal transduction . While the exact mechanisms linking specific PUFA alterations to functional deficits remain under investigation, the accumulation of autofluorescent spots observed in fundus photography of mutant mice suggests increased lipofuscin formation, a hallmark of aging photoreceptors and RPE cells . This multi-faceted molecular cascade highlights how Elovl2 dysfunction may accelerate age-related retinal pathology through altered lipid metabolism, increased oxidative stress, and activation of inflammatory processes.

What techniques are most effective for measuring Elovl2 expression in tissue samples?

Several complementary techniques can be employed to comprehensively assess Elovl2 expression in tissue samples:

  • RNAscope® In Situ Hybridization: This method allows visualization of Elovl2 mRNA with cellular resolution in tissue sections. The protocol involves treating fresh frozen histologic sections with hydrogen peroxide and target retrieval reagents, followed by hybridization with specific probes designed for mouse Elovl2 . Detection is achieved using TSA Plus® Fluorophores (fluorescein, cyanine 3, and cyanine 5), and sections are mounted with DAPI for imaging . This technique is particularly valuable for identifying the specific cell types expressing Elovl2 within complex tissues like the retina.

  • Western Blotting: For protein-level quantification, Western blotting can be performed using total protein isolated with TRIzol from target tissues . Typically, 10μg of protein is subjected to SDS-PAGE followed by immunoblotting with anti-ELOVL2 antibodies . Signal quantification should include normalization to loading controls such as H3 histone, with background subtraction performed using image analysis software like ImageJ .

  • Quantitative RT-PCR: For mRNA quantification, qRT-PCR remains a standard approach, allowing precise measurement of Elovl2 transcript levels across different tissues or experimental conditions .

  • DNA Methylation Analysis: Since Elovl2 expression is regulated by promoter methylation, techniques like reduced representation bisulfite sequencing (RRBS) can provide valuable information about the epigenetic status of the gene . This approach involves bisulfite conversion of DNA, which changes unmethylated cytosines to uracil while leaving methylated cytosines unchanged, followed by sequencing to determine methylation patterns.

These methods can be used individually or in combination to provide a comprehensive assessment of Elovl2 expression levels, cellular localization, and regulatory mechanisms in experimental settings.

What protocols should be used to assess visual function in Elovl2 mutant mice?

Electroretinography (ERG) represents the gold standard for functional assessment of the retina in Elovl2 mutant mice. While specific ERG protocols are not detailed in the provided research, standard procedures typically include:

  • Animal Preparation: Mice are dark-adapted overnight followed by anesthesia administration. Pupils are dilated using tropicamide and phenylephrine drops, and corneal electrodes are positioned with appropriate reference and ground electrodes .

  • Stimulus Parameters: ERG recordings should include both scotopic (dark-adapted) and photopic (light-adapted) conditions to assess rod and cone function, respectively. Multiple light intensities ranging from very dim (for rod-specific responses) to bright flashes (for mixed rod-cone responses) should be utilized .

  • Data Analysis: Key parameters to analyze include a-wave amplitude (reflecting photoreceptor function), b-wave amplitude (primarily bipolar cell activity), and implicit times for both waves. Comparison between wild-type littermates and Elovl2 mutant mice provides quantitative measures of visual function deficits .

  • Age-Dependent Assessment: Given Elovl2's role in aging, ERG recordings should be performed at multiple age points (e.g., 3, 6, 12, and 18 months) to track the progression of functional decline .

Complementary to ERG, fundus photography is essential for documenting the appearance of autofluorescent spots, which are established markers of retinal aging . This technique allows visualization and quantification of these spots, which appear consistently in Elovl2 C234W mutant mice by six months of age but are absent in wild-type littermates . Fundus imaging should be performed at regular intervals to monitor the progression of this phenotype, with particular attention to potential sex differences, as the phenotype appears more pronounced in male mice .

What methods are recommended for analyzing sub-RPE deposits in Elovl2 mutant mice?

Analysis of sub-RPE deposits in Elovl2 mutant mice requires a multi-faceted approach combining histological, immunohistochemical, and ultrastructural techniques:

  • Immunohistological Analysis: Fresh frozen or properly fixed retinal sections should be prepared from wild-type and Elovl2 mutant littermates . Immunostaining should target known components of human drusen, including:

    • Complement components (C3, C5b-9 membrane attack complex)

    • HTRA1 (high-temperature requirement A serine peptidase 1)

    • Oxidized lipids (using T15 antibody)

    • Apolipoproteins (particularly ApoE)

  • Fluorescence Microscopy: High-resolution fluorescence microscopy (such as with a Keyence BZ-X700 system) allows visualization of immunolabeled deposits . Focus should be placed on the sub-RPE region, particularly at the interface between the RPE and Bruch's membrane where deposits typically accumulate.

  • Quantification Parameters: Analysis should include measurement of:

    • Number of deposits per unit length of retina

    • Size distribution of deposits

    • Intensity of immunolabeling for specific markers

    • Co-localization analysis of multiple markers to determine deposit composition

  • Age-Dependent Analysis: Given the progressive nature of these deposits, analysis should be conducted at multiple age points to track their accumulation and compositional changes over time .

  • Comparative Analysis: Direct comparison with age-matched wild-type controls is essential to distinguish mutation-specific effects from normal age-related changes .

This comprehensive approach allows researchers to characterize the sub-RPE deposits in Elovl2 mutant mice and establish their similarity to human drusen, providing insights into the potential mechanisms linking Elovl2 dysfunction to age-related macular degeneration.

How can researchers effectively analyze Elovl2 promoter DNA methylation?

Analysis of Elovl2 promoter DNA methylation requires specialized techniques that can accurately quantify methylation levels at specific CpG sites:

  • Reduced Representation Bisulfite Sequencing (RRBS): This technique provides comprehensive methylation profiling of CpG-rich regions of the genome, including promoters . The method involves digestion of genomic DNA with methylation-insensitive restriction enzymes (typically MspI), followed by adapter ligation, bisulfite conversion, and high-throughput sequencing . For Elovl2 methylation analysis, RRBS data can be processed using standard bioinformatics pipelines, including quality control with FastQC and trimming with TrimGalore (typically 4bp from the 5' end to remove potential methylation bias) .

  • Bisulfite Pyrosequencing: For targeted analysis of specific CpG sites in the Elovl2 promoter, bisulfite pyrosequencing offers a quantitative approach with single-nucleotide resolution. This method involves bisulfite conversion of DNA followed by PCR amplification of the target region and sequencing that quantifies the ratio of cytosine to thymine at each CpG site (reflecting the original methylation status).

  • Methylation-Specific PCR (MSP): This technique uses primers designed to discriminate between methylated and unmethylated sequences after bisulfite conversion, providing a rapid assessment of methylation status at specific regions.

  • Comparative Analysis: Methylation data should be analyzed across different age groups and between wild-type and experimental conditions . For age-related studies, samples from young (3-month), middle-aged (12-month), and old (22+ month) mice provide a comprehensive view of methylation changes across the lifespan .

  • Correlation Analysis: Methylation data should be correlated with Elovl2 expression levels (measured by qRT-PCR or Western blot) to establish the relationship between epigenetic changes and gene expression .

These approaches enable researchers to accurately quantify Elovl2 promoter methylation and investigate its role in regulating gene expression during aging, providing valuable insights into the epigenetic mechanisms underlying age-related phenotypes.

What therapeutic strategies targeting Elovl2 show promise for age-related eye diseases?

Research suggests several potential therapeutic strategies targeting Elovl2 for age-related eye diseases:

  • Epigenetic Modulation: Intravitreal injection of 5-Aza-2'-deoxycytidine (5-Aza-dc), a DNA methyltransferase inhibitor, has demonstrated the ability to reverse Elovl2 promoter hypermethylation in vivo . This intervention leads to increased Elovl2 expression and rescue of age-related decline in visual function, suggesting that epigenetic drugs targeting DNA methylation could represent a viable therapeutic approach . The efficacy of this approach in restoring visual function in aged mice indicates that age-related epigenetic changes in Elovl2 may be reversible, opening possibilities for treatment of conditions like age-related macular degeneration (AMD).

  • PUFA Supplementation: Since Elovl2 is critical for the elongation of polyunsaturated fatty acids, particularly those leading to DHA production, dietary supplementation with specific PUFAs might partially compensate for reduced Elovl2 activity in aging or diseased retinas . DHA, as the main polyunsaturated fatty acid in the retina, promotes healthy retinal function and protects against damage from bright light and oxidative stress . Targeted supplementation with downstream products of the Elovl2 pathway could potentially bypass the need for enzymatic elongation.

  • Gene Therapy Approaches: Given the specific expression pattern of Elovl2 in retinal cells, particularly in cones and RPE, targeted gene therapy to restore Elovl2 expression in these cells represents another potential therapeutic avenue . This approach could provide long-term restoration of Elovl2 function in the retina.

  • Anti-Inflammatory Strategies: The presence of complement components and other inflammatory mediators in sub-RPE deposits of Elovl2 mutant mice suggests that inflammatory pathways contribute to the pathology . Therapies targeting these inflammatory pathways, particularly complement activation, might help mitigate the consequences of Elovl2 dysfunction in the retina.

These therapeutic strategies address different aspects of Elovl2 biology in the aging retina and could provide novel approaches for the treatment of age-related eye diseases, particularly non-exudative AMD for which there are currently no effective treatments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.