Recombinant Mouse Elongation of very long chain fatty acids protein 3 (Elovl3)

Shipped with Ice Packs
In Stock

Description

Molecular Classification and Family

Elongation of very long chain fatty acids protein 3 (Elovl3) belongs to the GNS1/SUR4 family of proteins that play essential roles in the elongation of long chain fatty acids, providing vital precursors for the synthesis of complex lipids such as sphingolipids and ceramides . This 271 amino acid protein functions as a condensing enzyme, catalyzing the first and rate-limiting reaction in the four-reaction sequence that constitutes the long-chain fatty acid elongation cycle . As an endoplasmic reticulum-bound enzyme, Elovl3 facilitates the critical addition of two carbon atoms to the chain of long and very long-chain fatty acids per cycle, significantly contributing to lipid diversity and cellular function .

The Elovl gene family encompasses seven members (Elovl1-7) in mammals, each characterized by distinct substrate preferences and tissue-specific expression patterns that reflect their specialized functions . Among these family members, Elovl3 exhibits specific activity toward both saturated and unsaturated acyl-CoA substrates, with notably higher activity toward C18 acyl-CoAs, particularly C18:0 (stearoyl-CoA) . This substrate specificity enables Elovl3 to generate specific very long chain fatty acids that serve crucial roles in various biological contexts.

Bioinformatic analysis using protein interaction databases reveals predicted functional partnerships between Elovl3 and other elongases, particularly Elovl1 and Elovl5, suggesting coordinated activities within this enzyme family . These relationships highlight the integrated nature of fatty acid elongation pathways and the cooperative functions of different elongases in maintaining proper lipid balance.

Physiological Significance

Elovl3 plays pivotal roles in multiple physiological systems through its involvement in very long chain fatty acid synthesis. Initially identified as a cold-inducible gene in brown adipose tissue, Elovl3 demonstrates context-dependent expression that suggests specialized functions in thermal regulation . Beyond this role, research has uncovered its critical importance in maintaining ocular surface health through its contribution to meibum biosynthesis, the oily secretion that prevents tear evaporation .

The physiological significance of Elovl3 is dramatically illustrated by studies of Elovl3 knockout (E3-KO) mice, which exhibit diverse and severe phenotypic abnormalities, particularly affecting the eyes. These include delayed eye opening, weeping eyes, crusty eyelids, eyelid edema, highly vascularized tarsal plates, and a distinctive slit eye appearance . Slit lamp evaluation revealed corneal neovascularization in 40% of E3-KO mice, indicating significant disruption to ocular surface homeostasis . These manifestations underscore Elovl3's essential role in generating the specific lipid composition required for proper ocular function.

Another fascinating aspect of Elovl3 biology is its pronounced sex-specific expression pattern in the liver. In mature male mice, hepatic Elovl3 mRNA expression follows a distinct diurnal rhythm, whereas in female mice and sexually immature males, Elovl3 expression remains consistently low . This sexual dimorphism suggests that Elovl3 may contribute to sex-specific aspects of hepatic lipid metabolism, potentially influenced by hormonal factors.

Protein Structure and Catalytic Mechanism

While the specific crystal structure of mouse Elovl3 has not been directly elucidated in the provided research, insights from studies on related ELOVL family members provide valuable structural information. Research on human ELOVL7 has revealed that ELOVL proteins adopt a seven-transmembrane helix (7TM) barrel structure, with the protein spanning the endoplasmic reticulum membrane . This arrangement creates a substrate tunnel that traverses the entire protein, extending from the cytoplasmic surface to the endoplasmic reticulum lumen .

Critical to the function of all ELOVL proteins, including Elovl3, is a canonical HxxHH motif that lines the active site and is essential for catalytic activity . Contrary to initial hypotheses that this histidine-rich motif might coordinate metal ions (similar to fatty acyl desaturases), structural evidence suggests that metal-assisted catalysis is unlikely in ELOVL elongases . Instead, these histidine residues appear to participate directly in the reaction mechanism.

The catalytic mechanism of Elovl3 involves the condensation of a long-chain acyl-CoA with malonyl-CoA, resulting in the addition of two carbon atoms to the acyl chain. Based on studies of ELOVL family proteins, the reaction likely begins with the binding of acyl-CoA at the active site, followed by binding of malonyl-CoA . Key histidine residues participate in the decarboxylation of malonyl-CoA, generating a nucleophilic enolate carbanion that reacts with the acyl-CoA substrate to form a 3-keto acyl-CoA product . This initial condensation reaction represents the rate-limiting step in the four-reaction elongation cycle, which subsequently involves reduction, dehydration, and a second reduction to yield the elongated acyl-CoA.

Tissue-Specific Expression

Elovl3 demonstrates distinctive tissue-specific expression patterns that correlate with its specialized functions in lipid metabolism. Originally identified as a cold-inducible gene in brown adipose tissue, Elovl3 has since been found in various tissues including liver and meibomian glands . This differential expression across tissues suggests context-dependent roles tailored to the specific lipid requirements of each tissue type.

In ocular tissues, Elovl3 is highly expressed in meibomian glands, which are specialized sebaceous glands located in the tarsal plates of the eyelids . These glands produce meibum, a complex mixture of lipids that forms the outermost layer of the tear film and prevents evaporation of the aqueous tear layer. The high expression of Elovl3 in these glands underscores its critical role in generating the specific very long chain fatty acids required for proper meibum composition and function.

The liver also exhibits significant Elovl3 expression, though with a striking sex-specific pattern that suggests hormonal regulation. In mature male mice, hepatic Elovl3 expression follows a distinct diurnal rhythm, whereas in female mice and sexually immature males, Elovl3 expression remains consistently low . This sexual dimorphism suggests that Elovl3 contributes to sex-specific aspects of hepatic lipid metabolism, potentially influenced by androgens and other hormonal factors.

Circadian Rhythm and Hormonal Control

One of the most fascinating aspects of Elovl3 regulation is its pronounced circadian expression pattern in the liver of male mice. Studies have revealed that hepatic Elovl3 mRNA expression follows a distinct diurnal rhythm exclusively in mature male mice, with a sharp increase early in the morning (Zeitgeber time (ZT) 20), peaking around ZT2, and returning to basal levels by the end of the light period at ZT10 . This precise temporal regulation suggests integration with the circadian clock machinery that coordinates metabolic processes with daily cycles of activity and rest.

The circadian regulation of Elovl3 appears to be under the control of steroid hormones. Research has demonstrated that Elovl3 expression is significantly induced by exposure to the synthetic glucocorticoid dexamethasone, suggesting that glucocorticoids contribute to its rhythmic expression . Additionally, the sex-specific expression pattern implies that androgens play a role in establishing the male-specific expression profile. Collectively, these findings indicate that Elovl3 expression in mouse liver is under strict diurnal control by circulating steroid hormones such as glucocorticoids and androgens .

Table 2: Circadian Expression Pattern of Elovl3 in Male Mouse Liver

Zeitgeber Time (ZT)Elovl3 Expression Level
ZT20 (early morning)Sharp increase begins
ZT2Peak expression
ZT10 (end of light period)Return to basal level

Role in Meibum Biosynthesis and Ocular Surface Physiology

One of the most well-documented functions of Elovl3 is its critical role in meibum biosynthesis and maintenance of ocular surface health. Meibum, the oily secretion produced by meibomian glands, forms the outermost layer of the tear film and prevents excessive evaporation of tears from the ocular surface. Studies have identified Elovl3 as highly expressed in the meibomian glands of both humans and mice, suggesting a conserved function in meibum production across species .

Research using Elovl3 knockout (E3-KO) mice has provided compelling evidence for its importance in ocular surface physiology. E3-KO mice exhibit multiple abnormal eye phenotypes, including delayed eye opening, weeping eyes, crusty eyelids, eyelid edema, highly vascularized tarsal plates, and a distinctive slit eye appearance . Slit lamp evaluation of these mice revealed corneal neovascularization in 40% of E3-KO mice, indicating significant corneal pathology resulting from Elovl3 deficiency .

The lipid composition of meibum is dramatically altered in E3-KO mice, with a much higher fluidity compared to wild-type mice . Mass spectrometric analysis revealed specific changes in cholesteryl ester (CE) composition, including a large increase in shorter chain CEs (C16-C19) and a decrease in very long chain CEs (C20-C27), with almost complete ablation of the C23 product . These alterations in lipid composition directly impact the physical properties of meibum and consequently affect its function in protecting the ocular surface.

The ocular surface abnormalities in E3-KO mice also include increased tear production and changes in eye geometry, with increased eccentricity of the eye openings . These phenotypic changes highlight the systemic impact of Elovl3 deficiency on ocular surface homeostasis and demonstrate the critical role of very long chain fatty acids in maintaining normal eye physiology.

Table 3: Phenotypic Abnormalities in Elovl3 Knockout Mice

PhenotypeDescription
Eye OpeningDelayed
Eyelid ConditionWeeping eyes, crusty eyelids, eyelid edema
Tarsal PlatesHighly vascularized
Eye AppearanceSlit eye appearance
Corneal HealthNeovascularization in 40% of E3-KO mice
Tear ProductionIncreased compared to wild-type mice
Eye GeometryIncreased eccentricity of eye openings
Meibum PropertiesHigher fluidity than wild-type mice

Involvement in Lipid Metabolism and Cross-talk with Fatty Acid Oxidation

Beyond its role in meibum biosynthesis, Elovl3 plays a broader role in lipid metabolism through its function in very long chain fatty acid synthesis. As a condensing enzyme in the fatty acid elongation cycle, Elovl3 contributes to the production of saturated and monounsaturated very long chain fatty acids that serve as precursors for the synthesis of more complex lipids, including sphingolipids and ceramides . These lipids are essential components of cellular membranes and important signaling molecules that regulate various cellular processes.

The diurnal regulation of hepatic Elovl3 expression suggests a role in circadian aspects of lipid metabolism in the liver. The sex-specific expression pattern further implies specialized functions in male-specific metabolic processes, potentially related to differences in fat storage, lipid processing, or hormone metabolism between males and females .

Interestingly, research has revealed a relationship between fatty acid synthesis and oxidation pathways that involves Elovl3. Studies have shown that Elovl3 expression is elevated in mice lacking the peroxisomal fatty acid transporter ATP-binding cassette, subfamily D (ALD), member 2 (ABCD2) and suppressed in mice overexpressing this transporter . This finding suggests a coordinated regulation of fatty acid synthesis and breakdown pathways, ensuring balanced lipid metabolism. Very long chain fatty acids produced with the involvement of Elovl3 may undergo subsequent peroxisomal β-oxidation, with ABCD2 facilitating their transport into peroxisomes for this process.

Table 4: Lipid Composition Changes in Elovl3 Knockout Mice

Lipid ClassChange in E3-KO Mice
Shorter Chain Cholesteryl Esters (C16-C19)Large increase
Very Long Chain Cholesteryl Esters (C20-C27)Decrease
C23 Cholesteryl EstersAlmost complete ablation

Recombinant Expression Systems and Production

Recombinant mouse Elongation of very long chain fatty acids protein 3 (Elovl3) represents a valuable research tool that enables detailed investigations into the structure, function, and regulation of this important enzyme. Commercial sources like MyBioSource.com offer recombinant mouse Elovl3 at a price point of $1,535.00, indicating the specialized nature and significant research value of this reagent .

The production of recombinant Elovl3 involves expression in suitable host systems that can properly fold and process this integral membrane protein. While the specific expression system used for commercial mouse Elovl3 is not detailed in the search results, insights from studies on related ELOVL proteins suggest potential approaches. Research on human ELOVL7 has demonstrated successful expression in both insect cells (Spodoptera frugiperda Sf9) and mammalian cells (Expi293F), with both systems yielding functional protein that retained its catalytic properties .

The recombinant expression of membrane proteins like Elovl3 presents particular challenges due to their hydrophobic nature and requirement for proper membrane insertion. Optimization of expression conditions, including appropriate detergents for solubilization and purification, is crucial for obtaining functional recombinant protein. Techniques such as affinity tagging (using polyhistidine or other fusion tags) facilitate efficient purification while maintaining protein structure and function.

Research Applications and Future Directions

Recombinant mouse Elovl3 serves as a valuable research tool for investigating various aspects of fatty acid elongation and lipid metabolism. Its applications span from basic biochemical characterization to more advanced structural and functional studies that provide insights into the molecular mechanisms of fatty acid elongation.

One important application involves antibody validation for immunological techniques. Recombinant protein fragments serve as controls for evaluating antibody specificity and optimizing experimental conditions. For example, human ELOVL3 control fragments are used in blocking experiments with corresponding antibodies for applications such as immunohistochemistry, immunocytochemistry, and Western blotting . These blocking experiments involve pre-incubating the antibody with excess recombinant protein to confirm specificity by demonstrating that the bound antibody no longer produces signal in subsequent assays.

Structural studies represent another critical application of recombinant Elovl3. Purified protein enables detailed structural analyses through techniques such as X-ray crystallography or cryo-electron microscopy, providing insights into the three-dimensional arrangement of the protein and the molecular basis of substrate specificity. These structural insights, in turn, inform understanding of how mutations or variations in Elovl3 might affect its function and contribute to disease states.

Enzymatic characterization using recombinant Elovl3 allows for precise determination of substrate preferences, reaction kinetics, and the effects of various modulators on enzyme activity. These studies provide fundamental information about the biochemical properties of Elovl3 and its specific role within the broader context of fatty acid elongation pathways.

Table 5: Comparative Analysis of ELOVL Family Members

ELOVL Family MemberPrimary Substrate PreferenceKey Functions
Elovl1Saturated and monounsaturated acyl-CoAs, highest activity toward C22:0 Production of very long chain fatty acids for various tissues
Elovl3Saturated and unsaturated acyl-CoAs, highest activity toward C18:0 Meibum biosynthesis, liver lipid metabolism with sexual dimorphism
Elovl5Polyunsaturated acyl-CoAs, highest activity toward C18:3(n-6) Elongation of polyunsaturated fatty acids

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Elovl3; Cig30; Elongation of very long chain fatty acids protein 3; 3-keto acyl-CoA synthase Elovl3; CIN-2; Cold-inducible glycoprotein of 30 kDa; ELOVL fatty acid elongase 3; ELOVL FA elongase 3; Very long chain 3-ketoacyl-CoA synthase 3; Very long chain 3-oxoacyl-CoA synthase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Elovl3
Target Protein Sequence
MDTSMNFSRGLKMDLMQPYDFETFQDLRPFLEEYWVSSFLIVVVYLLLIVVGQTYMRTRK SFSLQRPLILWSFFLAIFSILGTLRMWKFMATVMFTVGLKQTVCFAIYTDDAVVRFWSFL FLLSKVVELGDTAFIILRKRPLIFVHWYHHSTVLLFTSFGYKNKVPSGGWFMTMNFGVHS VMYTYYTMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWRQEKGCHTTTEHFFWS FMLYGTYFILFAHFFHRAYLRPKGKVASKSQ
Uniprot No.

Target Background

Function
Elovl3 catalyzes the initial and rate-limiting step in the four-reaction long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzymatic process facilitates the addition of two carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. This condensing enzyme exhibits activity towards saturated and unsaturated acyl-CoA substrates, demonstrating higher activity toward C18 acyl-CoAs, particularly C18:0 acyl-CoAs. Elovl3 may play a role in the production of saturated and monounsaturated VLCFAs of varying chain lengths, which are involved in various biological processes. These VLCFAs serve as precursors for membrane lipids and lipid mediators. Elovl3 participates in the formation of specific VLCFAs and triglycerides in certain hair follicle and sebaceous gland cells, essential for skin barrier function. It is a critical enzyme for lipid accumulation and metabolic activity in brown adipocytes during the early stages of tissue recruitment. Elovl3 plays a significant role in lipid storage and resistance to diet-induced obesity.
Gene References Into Functions
  1. Data, including findings from knockout mouse studies, suggest that signal transduction via calcitriol/calcitriol receptor regulates Elovl3 (fatty acid elongase 3) expression and alters fatty acid composition in subcutaneous (but not visceral) adipose tissue. PMID: 26488808
  2. Ablation of ELOVL3 leads to reduced adiponectin levels, restricted expansion of adipose tissue, and resistance against diet-induced obesity, a phenomenon more pronounced in female mice. PMID: 20605947
  3. ELOVL3 and fatty acid chain length contribute to the development of hair and skin function. PMID: 14581464
  4. This study demonstrates that cold-induced Elovl3 expression is under the control of peroxisome proliferator-activated receptor-alpha (PPARalpha). PMID: 15855229
  5. ELOVL3 is a key regulator of endogenous synthesis of saturated very long chain fatty acids and triglyceride formation in brown adipose tissue during the early phase of tissue recruitment. PMID: 16326704
  6. The upstream region of the Elovl3 gene is repressed by RevErbalpha and activated by sterol-regulatory element binding protein-1 (SREBP1) transcription factors. PMID: 17003504
  7. Elovl3 expression in mouse liver is subject to strict diurnal control by circulating steroid hormones such as glucocorticoids and androgens. PMID: 18292190

Show More

Hide All

Database Links
Protein Families
ELO family, ELOVL3 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brown adipose tissue and liver. In the skin, strong expressed in the cells of the inner layer of the outer root sheath of the hair follicles and in the sebocytes of the sebaceous glands. Hardly detectable in the epidermis and not at all in fi

Q&A

What is Elovl3 and what is its primary function?

Elovl3 (Elongation of very long chain fatty acids protein 3) is a member of the ELOVL family of enzymes that catalyzes the first and rate-limiting reaction of the four-step elongation cycle that synthesizes very long chain fatty acids (VLCFAs). It specifically elongates saturated and monounsaturated fatty acids with chain lengths of 18-24 carbons to produce C20-C24 VLCFAs . The enzyme is located in the endoplasmic reticulum membrane and is primarily expressed in brown and white adipose tissue, skin sebaceous glands, and liver .

How does Elovl3 differ from other ELOVL family proteins?

Elovl3 belongs to a family of seven elongases (ELOVL1-7), each with specific substrate preferences and tissue distribution patterns. While Elovl3 primarily elongates saturated fatty acids with chain lengths of 18-24 carbons, it can be functionally redundant with ELOVL1 and ELOVL7 for some substrates . Unlike ELOVL4, which can synthesize extremely long VLCFAs (≥26 carbons), Elovl3 typically produces C20-C24 fatty acids . The amino acid residues lining the acyl chain binding site of these enzymes are not well conserved, reflecting their differential abilities to accommodate different acyl chains .

What is the molecular structure of mouse Elovl3?

Mouse Elovl3 is a 271 amino acid protein . Like other ELOVL family members, it has multiple transmembrane domains that form a barrel-like structure with a central tunnel for substrate binding. The catalytic site is located at the center of the membrane, and the residues lining this section of the tunnel are highly conserved across all seven elongases . The mouse Elovl3 gene contains multiple exons, with the G-to-A transition at chromosome 19 position 46,133,123 bp (GRCm38) identified in some mutant strains .

How can I express recombinant mouse Elovl3 in vitro?

For recombinant expression of mouse Elovl3, researchers typically use PCR amplification of mouse liver cDNA with specific primers (Forward primer: GCCACCATGGACACATCCATGAATTTCTCAC; Reverse primer: GGATCCTTGGCTCTTGGATGCAACTTTG), followed by cloning into an expression vector such as pcDNA3.1 . The resulting construct can be transfected into mammalian cell lines (e.g., HeLa or Huh7 cells) or transformed into competent E. coli for plasmid preparation . For protein purification, specialized tags may be added to facilitate isolation of the membrane-bound protein.

What methods are effective for detecting and quantifying Elovl3 expression?

Multiple approaches can be used to detect and quantify Elovl3:

  • RNA level detection: qRT-PCR using Elovl3-specific primers is the most common method for mRNA quantification. For comprehensive analysis, researchers can amplify Elovl3 cDNA sequences spanning 5′ untranslated region through 3′ untranslated region .

  • Protein level detection: Western blotting, immunohistochemistry, and ELISA using specific anti-Elovl3 antibodies can detect the protein . Commercial antibodies are available that react with human or mouse Elovl3, with applications including Western blot, ELISA, immunohistochemistry, and immunofluorescence .

  • Functional assays: Fatty acid elongation activity can be measured by analyzing the condensation activity of the elongation enzyme using radiolabeled or stable isotope-labeled substrates .

How can I develop an Elovl3 knockout model to study its function?

Several approaches for developing Elovl3 knockout models include:

  • Constitutive knockout: Traditional gene targeting has been used to generate Elovl3-ablated mice, which display phenotypes including impaired skin barrier, hair loss, and inability to properly recruit brown adipose tissue during cold stress .

  • Conditional knockout: Using Cre-loxP systems for tissue-specific deletion can help distinguish tissue-specific functions and avoid potential developmental complications.

  • siRNA-mediated knockdown: For in vitro studies, Elovl3 siRNAs (such as si-713-ELOVL3, si-394-ELOVL3, and si-410-ELOVL3) have been effective in knocking down Elovl3 expression. In porcine preadipocytes, si-713-ELOVL3 significantly reduced Elovl3 mRNA levels and inhibited lipid accumulation .

  • CRISPR-Cas9: This technology can be used to generate specific mutations or deletions in the Elovl3 gene in various cell lines or animal models.

What is the role of Elovl3 in brown adipose tissue and thermogenesis?

Elovl3 plays a crucial role in brown adipose tissue (BAT) function and thermogenesis:

  • Cold adaptation: During cold exposure, Elovl3 mRNA levels are dramatically elevated (>200-fold) in BAT of mice, suggesting a critical role in cold adaptation .

  • Lipid accumulation: Elovl3-ablated mice show diminished ability to accumulate fat and reduced metabolic capacity within brown fat cells. This indicates that Elovl3 is an important regulator of endogenous synthesis of saturated VLCFAs and triglyceride formation in BAT during the early phase of tissue recruitment .

  • Thermogenic response: While cold-acclimated Elovl3-ablated mice experience increased heat loss due to impaired skin barrier, they are unable to hyperrecruit their BAT and instead rely on muscle shivering to maintain body temperature .

How does Elovl3 contribute to liver development and regeneration?

Elovl3 appears to play a regulatory role in liver development and regeneration:

  • Developmental regulation: Elovl3 mRNA levels are extremely low in embryonic livers and increase postnatally, with male-biased expression established between 4-8 weeks of age in mice .

  • Cell cycle regulation: Forced expression of Elovl3 slows the growth of human hepatoma cells (Huh7) and stalls HeLa cell cycle progression in S-phase, with significant reductions in the expression of Cyclins D, A, and E .

  • Liver regeneration: Elovl3 is dramatically repressed during liver regeneration models (e.g., after CCl₄ treatment or partial hepatectomy), suggesting that its downregulation permits cellular expansion .

  • VLCFA metabolism: Reduced Elovl3 expression during liver regeneration is associated with lower hepatic concentrations of C22:1 monounsaturated and C20:0-C22:0 saturated VLCFAs .

What phenotypes are observed in Elovl3 knockout mice?

Elovl3 knockout mice display several distinctive phenotypes:

  • Skin and hair abnormalities: Knockout of Elovl3 in mice disrupts the water barrier of the skin, causes hyperplasia of the sebaceous glands, and leads to hair loss .

  • Adipose tissue dysfunction: Elovl3-ablated mice show diminished ability to accumulate fat and reduced metabolic capacity in brown adipose tissue, affecting their thermogenic response .

  • Meibomian gland effects: Absence of Elovl3 leads to selective changes in the lipid composition of meibum (the oily secretion from meibomian glands), affecting ocular surface physiology. Major classes of meibomian lipids affected include cholesteryl esters, wax esters, and cholesteryl esters of (O)-acylated ω-hydroxy fatty acids .

  • VLCFA synthesis: Lack of Elovl3 results in a transient decrease in the capacity to elongate saturated fatty acyl-CoAs into VLCFAs, with reduced levels of arachidic acid (C20:0) and behenic acid (C22:0) in brown adipose tissue during initial cold stress .

How is Elovl3 expression regulated at the transcriptional level?

Elovl3 expression is regulated by several transcriptional mechanisms:

  • ZHX2 activation: The zinc fingers and homeoboxes 2 (ZHX2) transcription factor directly binds to the Elovl3 promoter and an upstream DNase hypersensitive site (DHS) to activate transcription. Microarray data from BALB/cJ and Zhx2-positive congenic mice showed a positive correlation between Zhx2 and Elovl3 expression levels .

  • Sex-specific regulation: Elovl3 exhibits sex-biased expression in liver, with higher expression in males. This sex-specific pattern establishes between 4-8 weeks of age in mice, coinciding with sexual maturation .

  • Hormonal regulation: Androgens are required for male-biased hepatic Elovl3 expression, while estrogen receptor signaling may maintain lower Elovl3 mRNA levels in female mice .

  • p53 activation: The tumor suppressor p53, which has a well-established role in cell cycle arrest, transcriptionally activates Elovl3 .

How do hormones affect Elovl3 expression and function?

Hormones play significant roles in regulating Elovl3:

How does Elovl3 influence cell cycle progression and proliferation?

Recent research has revealed an important connection between Elovl3 and cell cycle regulation:

  • S-phase stalling: When ELOVL3 is overexpressed in synchronized HeLa cells, cell cycle progression stalls in S-phase, with significant reductions in the expression of Cyclins D, A, and E, key regulators of cell cycle progression .

  • Growth inhibition: Forced expression of ELOVL3 slows the in vitro growth of human hepatoma Huh7 cells .

  • Developmental pattern: The expression pattern of Elovl3 (extremely low in embryonic livers, increasing postnatally, and decreasing dramatically during liver regeneration) supports the hypothesis that Elovl3 may inhibit cellular proliferation and that its downregulation permits cellular expansion .

  • Tumor suppression: Analysis of published datasets indicates that Elovl3 expression is lower during liver regeneration after partial hepatectomy in mice, and that ELOVL3 expression is higher in leukemia cells with GSK3-inhibition to block proliferation .

What is the relationship between Elovl3-produced VLCFAs and cellular function?

VLCFAs produced by Elovl3 appear to have significant effects on cellular functions:

  • Bioactive lipid production: The C20 to C24 saturated and monounsaturated VLCFAs synthesized by ELOVL3 are often incorporated into ceramides and other classes of bioactive lipids that can regulate cellular growth, differentiation, proliferation, and other physiological functions .

  • Ceramide synthesis: Ceramides containing VLCFAs are effective tumor suppressors, inducing apoptosis and reducing proliferation through cell cycle arrest. Reduced Elovl3 expression during liver regeneration results in lower hepatic C20-C22 VLCFA levels, which may reduce certain bioactive lipids and allow increased cellular proliferation .

  • Membrane composition: VLCFAs contribute to membrane structure and function, particularly in specialized tissues like skin, meibomian glands, and brown adipose tissue.

How can Elovl3 research contribute to understanding human diseases?

While mutations in Elovl3 have not been directly linked to human diseases, research on this protein has implications for several pathological conditions:

  • Liver diseases: Given Elovl3's role in liver development and regeneration, and its regulation by Zhx2 (whose targets are dysregulated in liver disease), understanding Elovl3 function could provide insights into liver pathologies involving dysregulated lipid metabolism .

  • Metabolic disorders: Elovl3's importance in brown adipose tissue function and lipid metabolism suggests potential relevance to metabolic disorders and obesity.

  • Skin conditions: The role of Elovl3 in maintaining skin barrier function indicates that it may be relevant to skin disorders characterized by barrier dysfunction.

  • Cancer biology: The observation that Elovl3 can inhibit cell proliferation and is regulated by the tumor suppressor p53 suggests potential relevance to cancer biology, particularly hepatocellular carcinoma .

What are the latest methodological approaches for studying Elovl3's enzymatic mechanism?

Recent methodological advances for studying Elovl3 include:

  • Structural studies: Research on related ELOVL proteins has revealed their molecular architecture, including a barrel-like structure with a central tunnel for substrate binding. The acyl chain binding site of these enzymes lies in a tunnel within the membrane, with the CoA binding site at the open, cytoplasmic end .

  • Metabolic tracing: Detailed metabolic tracing using stable isotope-labeled precursors can help elucidate the specific lipid species produced by ELOVL3 and their metabolic fates.

  • Single-cell techniques: Single-cell RNA sequencing and proteomics can reveal cell-specific expression patterns and functions of Elovl3 within heterogeneous tissues.

  • Dual-luciferase reporter assays: These assays have been used to study the transcriptional regulation of Elovl3, demonstrating how factors like the androgen receptor can inhibit Elovl3 promoter activity .

How conserved is Elovl3 across species?

Elovl3 shows considerable evolutionary conservation:

  • Mammalian orthologs: ELOVL3 gene orthologs have been reported in mouse, rat, bovine, and human, with conserved function in VLCFA synthesis .

  • Non-mammalian vertebrates: Orthologs have also been identified in frog, chimpanzee, and chicken species, suggesting important conserved functions across vertebrates .

  • Functional conservation: While sequence conservation varies, the catalytic function of elongating specific fatty acids appears to be maintained across species, though with potential differences in tissue expression patterns and regulatory mechanisms.

What are the species-specific differences in Elovl3 function and regulation?

While the fundamental enzymatic function of Elovl3 is conserved across species, several species-specific differences have been observed:

  • Tissue expression: Expression patterns vary somewhat between species, though liver, skin, and adipose tissue expression is commonly observed.

  • Hormonal regulation: While testosterone regulates Elovl3 in multiple species, the direction of regulation may differ. In mice, androgens increase hepatic Elovl3 expression , while in porcine preadipocytes, testosterone inhibits Elovl3 expression .

  • Cold adaptation: The dramatic upregulation of Elovl3 in response to cold exposure in mice points to its evolution as part of the mammalian thermogenic adaptation system, which may vary in importance across species with different thermoregulatory needs.

Table 1: Elovl3 Expression in Mouse Tissues Under Different Conditions

TissueNormal ConditionCold ExposureRegeneration/InjurySex Differences
Brown Adipose TissueModerate>200-fold increaseN/AMinimal
LiverLow in embryonic, increases postnatallyNot significantDramatically decreasedHigher in males (4-8 weeks onwards)
SkinPresent in sebaceous glandsN/AN/ANot significant
TestisHigh expressionN/AN/AMale-specific

Table compiled from data in references , , , and

Table 2: VLCFAs Affected by Elovl3 Deficiency in Mouse Liver During Regeneration

Fatty AcidControl Liver (relative %)Regenerating Liver (relative %)Significance
C20:0 (Arachidic acid)100Significantly decreasedp < 0.05
C22:0 (Behenic acid)100Significantly decreasedp < 0.05
C22:1 (Monounsaturated)100Significantly decreasedp < 0.05
C18:0 (Stearic acid)100No significant changeN/A
C18:1 (Oleic acid)100No significant changeN/A

Table based on data described in reference

Table 3: Effect of Elovl3 Expression on Cell Cycle Distribution

Cell Cycle PhaseControl Cells (%)ELOVL3-Expressing Cells (%)Change
G0/G160-6545-50Decreased
S20-2540-45Increased significantly
G2/M15-2010-15Decreased

Table based on data described in reference

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.