Recombinant Mouse Elongation of very long chain fatty acids protein 4 (Elovl4)

Shipped with Ice Packs
In Stock

Description

Biosynthesis and Expression Systems

Recombinant Elovl4 is produced using adenoviral vectors for high-yield expression:

  • Adeno-X Expression System: Mouse Elovl4 cDNA cloned into pDNR-CMV donor vector, followed by Cre-lox recombination into adenovirus type 5 backbone .

  • Cell lines: Expressed in neonatal rat cardiomyocytes and human ARPE-19 retinal pigment epithelial cells, achieving >90% transduction efficiency .

  • Protein detection: Confirmed via Western blot using antibodies specific to mouse/rat ELOVL4 .

Functional Roles in Lipid Metabolism

Recombinant Elovl4 demonstrates substrate-specific elongation activities:

Saturated Fatty Acid Elongation

  • Converts 24:0 (lignoceric acid)26:0 via endogenous elongases .

  • Uniquely elongates 26:028:030:0 in Elovl4-transduced cells .

Polyunsaturated Fatty Acid (PUFA) Synthesis

  • Catalyzes elongation of C26–C38 VLC-PUFA, critical for retinal phosphatidylcholine and brain sphingolipids .

  • Preferential use of 20:5n3 and 22:5n3 precursors over 22:6n3 .

Table 2: Fatty Acid Elongation Activity

SubstrateProduct (Elovl4-dependent)Tissue Relevance
24:026:0 → 28:0 → 30:0Skin, retina
20:5n3C28–C38 VLC-PUFAPhotoreceptor membranes

In Vitro Studies

  • Cardiomyocytes: Elovl4 overexpression increased 28:0 levels by 79% compared to controls .

  • ARPE-19 cells: 77% increase in 28:0 synthesis, confirming enzyme specificity for C26→C28 elongation .

Dominant-Negative Effects

  • Truncated Elovl4 mutants (e.g., STGD3-associated 5-bp deletion) sequester wild-type Elovl4 into cytosolic aggregates, disrupting ER localization .

  • Co-expression studies show mutant Elovl4 triggers endoplasmic reticulum stress via unfolded protein response activation .

Physiological Implications

  • Retinal function: Essential for synthesizing VLC-PUFA in rod outer segments; deficiencies cause photoreceptor degeneration .

  • Skin barrier integrity: Homozygous Elovl4 knockout mice exhibit lethal dehydration due to defective stratum corneum lipids .

  • Neuroprotection: VLC-FA from Elovl4 activity supports synaptic signaling and neuronal survival .

Comparative Analysis of Mutant Models

ModelPhenotypeLipid Deficiency
Elovl4 knockoutPerinatal lethality (dehydration)Loss of C28–C36 acylceramides
Elovl4 Y270XDefective epidermal barrierReduced free fatty acids >C26
Heterozygous mutantsProgressive retinal degenerationPartial VLC-PUFA depletion

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Elovl4; Elongation of very long chain fatty acids protein 4; 3-keto acyl-CoA synthase Elovl4; ELOVL fatty acid elongase 4; ELOVL FA elongase 4; Very long chain 3-ketoacyl-CoA synthase 4; Very long chain 3-oxoacyl-CoA synthase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Elovl4
Target Protein Sequence
MGLLDSEPGSVLNAMSTAFNDTVEFYRWTWTIADKRVADWPLMQSPWPTISISTLYLLFV WLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNDVN EVRIAGALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQ AFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLVQFHVTIGHTALSLYTD CPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPKQSKTGKTATNGISSNGVNKSEKALEN GKPQKNGKPKGE
Uniprot No.

Target Background

Function
This endoplasmic reticulum-bound enzyme catalyzes the rate-limiting, initial step in the four-reaction long-chain fatty acid elongation cycle. This process adds two carbons per cycle to long- and very long-chain fatty acids (VLCFAs). As a condensing enzyme, it synthesizes very long-chain saturated (VLC-SFA) and polyunsaturated (PUFA) fatty acids, which serve as precursors for membrane lipids and lipid mediators in various biological processes. It may play a critical role in early brain and skin development.
Gene References Into Functions
  1. These studies establish a critical, novel role for ELOVL4 and its VLC-SFA products in regulating synaptic release kinetics and epileptogenesis. PMID: 29168048
  2. Abnormal ELOVL4 protein in phagosomes impairs recruitment of motor protein linkers, leading to slower degradation due to altered motility and reduced encounters with endolysosomes. PMID: 29735674
  3. ELOVL4 is significantly reduced in the diabetic retina. PMID: 29362226
  4. ELOVL4 gene mutations cause cone degeneration in humans, while mouse models with mutant Elovl4 exhibit primarily rod degeneration. PMID: 29293603
  5. Knock-IN and Knock-OUT ELOVL4 (STGD3) models have elucidated the causal link between genotype and early-onset progressive cone degeneration in humans. PMID: 26427404
  6. ELOVL4 enzymatic activity is regulated by individual histidines in its active site and the endoplasmic reticulum microenvironment. PMID: 24569140
  7. Conditional deletion of Elovl4 in mouse rod and cone photoreceptors revealed its role in VLC-PUFAs and their impact on inner retina function, synaptic connectivity, and rod terminal ultrastructure. PMID: 24764063
  8. Expression and outer segment mislocalization of the disease-linked 5-base-pair deletion mutant ELOVL4 protein alter photoreceptor structure and function. PMID: 24833735
  9. Rod-expressed ELOVL4 protein mosaic deletion resulted in a 36% reduction of very long chain-PUFA in the retinal phosphatidylcholine (PC) fraction compared to wild-type mice. PMID: 24664753
  10. ELOVL4 is strongly expressed in holocrine meibomian and sebaceous glands, but not in the central meibomian duct. PMID: 24677106
  11. Mutant ELOVL4 does not affect wild-type ELOVL4 function in fully developed (8-10 week old) retinas. PMID: 24644051
  12. Role of ELOVL4 and very long-chain polyunsaturated fatty acids in mouse models of Stargardt type 3 retinal degeneration. PMID: 23479632
  13. Critical role of Elovl4 for proper rod or cone photoreceptor function. PMID: 22199362
  14. Epidermal Elovl4 transgene expression rescues neonatal lethality in homozygous Stargardt disease-3 mice. PMID: 21429867
  15. ELOVL4 protein is not involved in docosahexaenoic acid biosynthesis from 18:3n3 and 22:5n3 short-chain fatty acid precursors. PMID: 20238022
  16. ELOVL4 deficit leads to human STGD3 pathology. PMID: 17983602
  17. The ELOVL4 gene is highly conserved and expressed in retinal photoreceptor cells across various species. PMID: 12824221
  18. Elovl4 expression in the developing retina shows a dynamic pattern, shifting from predominant ganglion cell expression in embryonic and early postnatal stages to predominant expression in photoreceptor inner segments. PMID: 12847421
  19. ELOVL4 plays an important role in embryonic development and maintains normal retinal and brain physiology in later developmental stages. PMID: 15028285
  20. ELOVL4 is essential for very long-chain fatty acid synthesis, crucial for epidermal barrier function; lack of epidermal omega-O-acylceramides is incompatible with survival in a dry environment. PMID: 17208947
  21. These results highlight the importance of long-chain fatty acids in skin barrier development, suggesting Elovl4's involvement in C26 and longer fatty acid elongation. PMID: 17304340
  22. ELOVL4 is required for very long-chain fatty acid synthesis, essential for skin's water permeability barrier function. PMID: 17311087
  23. Mouse models of genetic macular degeneration include studies on Elovl4. PMID: 17368622
  24. ELOVL4 deficit leads to human STGD3 pathology. PMID: 17983602
  25. ELOVL4's role in fatty acid metabolism is reported. PMID: 18188956
  26. ELOVL4 is required for the synthesis of C28 and C30 saturated fatty acids (VLC-FA) and C28-C38 very long-chain polyunsaturated fatty acids (VLC-PUFA). PMID: 18728184
Database Links
Protein Families
ELO family, ELOVL4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the retina, exclusively in photoreceptor cells and in the brain, skin, testis and lens.

Q&A

What is mouse Elovl4 and what is its primary function in lipid metabolism?

Mouse Elovl4 (Elongation of Very Long chain fatty acids-4) belongs to the ELOVL family of fatty acid elongases that collectively catalyze the formation of long chain fatty acids. Elovl4 is uniquely responsible for producing Very Long Chain Saturated Fatty Acids (VLC-SFA) and Very Long Chain Polyunsaturated Fatty Acids (VLC-PUFA) with chain lengths ≥28 carbons . The protein functions by catalyzing the first step in fatty acid elongation, a condensation reaction between a fatty acyl-CoA and malonyl-CoA .

This elongation occurs through a four-step cycling process involving condensation, reduction, dehydration, and reduction again, with two carbon atoms added through each cycle. Elovl4 specifically mediates the elongation of long chain PUFA and SFA to form VLC-PUFA and VLC-SFA of 28 carbon chain length, which can be further elongated to produce species with chain lengths up to 38 carbons .

How is Elovl4 expression regulated during mouse brain development?

Elovl4 expression follows a specific developmental pattern in the mouse brain. Gene expression begins at late embryonic stages, peaks around postnatal day 1 (P1), and then declines by P30, after which it appears to be maintained at a steady-state level . This developmental regulation suggests important roles for Elovl4 and its VLC-fatty acid products in both brain development and mature brain function.

Immunohistochemistry studies show that ELOVL4 is widely expressed in the developing brain by embryonic day 18 (E18), with particularly pronounced expression in regions underlying the lateral ventricles and other neurogenic regions . The basal ganglia show especially intense ELOVL4 labeling at this stage. The distribution of ELOVL4 in the developing postnatal brain at P10 is transitional between the late embryonic stage and its distribution by P19–21, which closely resembles the adult pattern at P60 .

What mouse models are currently available for studying Elovl4 function?

Several mouse models have been developed to study Elovl4 function, particularly in relation to disease conditions. These include:

  • Y270X knockin mice: These mice were developed to model the dominant pathogenic mode of degeneration in human Stargardt macular dystrophy (STGD3) patients . The Y270X mutation results in a truncated Elovl4 protein.

  • Heterozygous knockout mice: These mice have a targeted deletion in the Elovl4 gene, specifically a 62-base-pair deletion in exon 2 . These animals have been used to study the role of Elovl4 in retinal/macular degeneration.

  • Homozygous knockout mice: Complete knockout of Elovl4 results in non-viable pups, indicating the essential nature of this gene for development .

These models provide valuable tools for understanding the physiological roles of Elovl4 and the pathological consequences of its mutation or loss.

How are Y270X knockin mice generated and what phenotypes do they display?

The generation of Y270X knockin mice involves several key steps in genetic engineering :

  • A mouse Elovl4 knockin targeting construct is created containing:

    • A neo cassette flanked by loxP sites

    • The Y270X mutation and HA-tagged Elovl4 fragment introduced into exon 6

  • This targeting vector is electroporated into mouse embryonic stem (ES) cells derived from 129 strain mice.

  • Clones in which homologous recombination resulted in targeted replacement of exon 6 are identified by PCR and Southern blotting.

  • Chimeric mice are bred with wild-type C57Bl/6 mice for germline transmission of the recombinant Elovl4 gene.

These knockin mice serve as an important animal model for examining autosomal dominant macular degeneration in Stargardt (STGD) patients . The phenotypes of these mice parallel aspects of human Stargardt-like macular dystrophy, providing insights into the mechanisms of this disease.

Why are homozygous Elovl4 knockout mice non-viable and what does this tell us about Elovl4 function?

Studies have demonstrated that homozygous Elovl4 knockout mice are non-viable, indicating that complete loss of Elovl4 function is incompatible with life . This finding highlights the essential role of Elovl4 and its VLC-fatty acid products in development.

The non-viability of homozygous knockouts suggests that Elovl4 has critical functions that cannot be compensated for by other elongases, despite some functional redundancy among ELOVL family members for certain substrate reactions . This is consistent with the observation that Elovl4 is the only ELOVL family member that catalyzes production of VLC-SFA and VLC-PUFA with chain lengths ≥28 carbons .

This finding also parallels observations in humans, where homozygous mutations in ELOVL4 cause severe neurological disorders characterized by seizures, intellectual disability, and neurodegenerative disease . These severe phenotypes further emphasize the critical importance of ELOVL4 function in neural development and maintenance.

What methods are effective for analyzing Elovl4 expression in mouse tissues?

Several complementary techniques have proven effective for analyzing Elovl4 expression:

  • Immunohistochemistry/Immunolabeling: This approach uses ELOVL4-specific antibodies to visualize protein expression patterns in tissue sections. Studies have used this method to map ELOVL4 distribution in the mature and developing mouse brain in combination with neuron and glia-specific markers . This technique reveals that ELOVL4 is widely expressed in a region- and cell type-specific manner, restricted to cell bodies consistent with its localization to endoplasmic reticulum.

  • In situ hybridization: This method detects Elovl4 mRNA expression in tissue sections. Resources like the Allen Institute for Brain Science provide comprehensive in situ hybridization data for Elovl4 expression at different developmental stages .

  • RT-PCR and qPCR: These techniques quantify Elovl4 mRNA levels in tissue samples and can detect changes in expression across developmental stages or experimental conditions.

  • Western blotting: This method quantifies ELOVL4 protein levels and can be used to confirm antibody specificity for immunohistochemistry studies.

For comprehensive analysis, combining these methods provides the most complete picture of Elovl4 expression patterns.

How can the enzymatic activity of recombinant mouse Elovl4 be assessed?

Assessing the enzymatic activity of recombinant mouse Elovl4 typically involves measuring its ability to elongate specific fatty acid substrates. A methodological approach includes:

  • Expression of recombinant Elovl4: The mouse Elovl4 cDNA can be cloned into an appropriate expression vector and expressed in cells that have low endogenous elongase activity.

  • Substrate incubation: The expressing cells or purified enzyme is incubated with potential substrates such as EPA (20:5n3), DPA (22:5n3), or other long-chain fatty acids along with malonyl-CoA as the carbon donor .

  • Fatty acid analysis: Following incubation, lipids are extracted and analyzed using techniques such as gas chromatography-mass spectrometry (GC-MS) to detect and quantify the elongated products.

  • Product identification: The analysis identifies newly formed VLC-PUFA or VLC-SFA species, with chain lengths of 28 carbons or longer being indicative of Elovl4 activity .

This approach allows researchers to determine the substrate specificity of Elovl4 and quantify its elongation activity under various experimental conditions.

What are effective strategies for generating conditional Elovl4 knockout models?

Conditional knockout models are valuable for studying gene function in specific tissues or developmental stages. For Elovl4, this approach is particularly important given the embryonic lethality of constitutive homozygous knockouts. Effective strategies include:

  • Cre-loxP system implementation:

    • Design a targeting construct with loxP sites flanking critical exon(s) of the Elovl4 gene

    • Generate mice carrying the floxed Elovl4 allele through homologous recombination in ES cells

    • Cross these mice with tissue-specific or inducible Cre recombinase-expressing lines

  • Tissue-specific knockouts: Crossing floxed Elovl4 mice with lines expressing Cre under tissue-specific promoters (e.g., Nestin-Cre for neural tissues or RPE-Cre for retinal pigment epithelium) allows examination of Elovl4 function in specific cell types.

  • Temporal control: Using tamoxifen-inducible CreERT2 systems permits deletion of Elovl4 at specific developmental timepoints, circumventing embryonic lethality.

  • Validation: Confirm knockout efficiency through PCR genotyping, RT-PCR, Western blotting, and immunohistochemistry in the targeted tissues.

These approaches enable more precise dissection of Elovl4 functions in different contexts while avoiding the complications of complete developmental lethality.

How do mutations in Elovl4 contribute to different disease phenotypes?

Different mutations in Elovl4 lead to distinct disease phenotypes, suggesting complex functions of this protein in various tissues. The relationship between mutation type and disease manifestation reveals important insights about Elovl4 function:

  • Heterozygous mutations affecting the C-terminus (including the Y270X mutation) cause autosomal dominant Stargardt-like macular dystrophy (STGD3) without significant skin or CNS involvement . These mutations result in truncated proteins that lack the ER retention signal, suggesting that proper localization of ELOVL4 is critical for retinal function.

  • Other heterozygous mutations cause autosomal dominant spinocerebellar ataxia (SCA34) and/or erythrokeratodermia variabilis (EKV) with no significant retinal phenotype . This suggests tissue-specific requirements for different ELOVL4 functions or products.

  • Homozygous mutations cause severe neurological disorders characterized by seizures, intellectual disability, and neurodegenerative disease . The more severe phenotype indicates a dose-dependent relationship between ELOVL4 function and neurological health.

These genotype-phenotype correlations suggest that different tissues have varying requirements for VLC-SFA and VLC-PUFA products of ELOVL4, and that the protein may have tissue-specific functions beyond its enzymatic activity.

What is the relationship between Elovl4-produced fatty acids and synaptic function?

ELOVL4 and its VLC-fatty acid products are emerging as important regulators of synaptic signaling and neuronal survival in the central nervous system . The specific mechanisms through which these lipids influence synaptic function include:

  • Membrane composition effects: VLC-fatty acids produced by ELOVL4 are incorporated into membrane phospholipids, potentially altering membrane fluidity, curvature, and the organization of lipid microdomains that serve as platforms for synaptic proteins.

  • Signaling roles: VLC-PUFA may serve as precursors for bioactive lipid signaling molecules that modulate synaptic transmission and plasticity.

  • Developmental regulation: The distinctive developmental expression pattern of Elovl4, peaking around postnatal day 1 , coincides with a critical period of synaptogenesis, suggesting a role in establishing proper synaptic connections.

  • Regional specificity: The region-specific expression of ELOVL4 in the brain, particularly in areas known for high synaptic plasticity, further supports its role in synaptic function.

Understanding these relationships can provide insights into both normal brain function and the pathogenesis of neurological disorders associated with ELOVL4 mutations.

How does the transmembrane topology of Elovl4 influence its function?

The transmembrane topology of ELOVL4 is critical for its enzymatic function and has been the subject of different structural models:

  • Five-transmembrane model: This model predicts ELOVL4 spans the ER membrane five times . This arrangement positions specific functional domains of the protein in either the ER lumen or cytoplasm, influencing substrate accessibility and interactions with other elongation machinery components.

  • Seven-transmembrane model: An alternative model suggests ELOVL4 has seven membrane-spanning domains . This different topology would alter the functional organization of the protein and potentially its interactions with other proteins or substrates.

The C-terminal region of ELOVL4 contains an ER retention signal that is critical for proper localization. Mutations that disrupt this region (like the Y270X mutation) result in mislocalization of the protein, contributing to disease pathogenesis .

ELOVL4 is thought to form hetero-oligomeric complexes in the ER with other components of the elongation machinery . The transmembrane arrangement influences these protein-protein interactions, which are essential for coordinating the four-step elongation cycle.

Understanding the true topology of ELOVL4 and how it facilitates enzymatic function remains an active area of research with implications for developing therapeutic approaches for ELOVL4-related diseases.

How should researchers interpret changes in VLC-fatty acid profiles in Elovl4 mutant models?

Interpreting changes in VLC-fatty acid profiles in Elovl4 mutant models requires careful consideration of several factors:

When interpreting these complex data, researchers should consider both the direct enzymatic function of Elovl4 and the broader metabolic and physiological contexts in which the enzyme operates.

What controls are essential for validating recombinant Elovl4 expression studies?

Proper validation of recombinant Elovl4 expression requires several critical controls:

  • Empty vector controls: Cells transfected with the expression vector lacking the Elovl4 insert are essential to distinguish effects of Elovl4 expression from those of the expression system itself.

  • Enzymatically inactive mutants: Including a catalytically inactive Elovl4 mutant (e.g., with mutations in the active site) helps distinguish effects due to enzymatic activity from potential structural roles of the protein.

  • Wild-type vs. disease mutations: Comparing wild-type Elovl4 expression with known disease-causing mutations (e.g., Y270X) can provide insights into pathogenic mechanisms.

  • Verification of expression and localization:

    • Western blotting to confirm protein expression at expected molecular weight

    • Immunofluorescence to verify proper localization to the endoplasmic reticulum

    • RT-PCR to confirm mRNA expression levels

  • Fatty acid profile analysis: Measuring changes in VLC-fatty acid levels to confirm functional activity of the expressed Elovl4 protein.

  • Tissue-specific expression considerations: When expressing Elovl4 in cell lines, it's important to consider the endogenous expression of other elongases and related enzymes that might influence the observed effects.

These controls help ensure that observed phenotypes are specifically attributable to Elovl4 function rather than experimental artifacts or secondary effects.

What statistical approaches are appropriate for analyzing complex phenotypes in Elovl4 mouse models?

Analyzing complex phenotypes in Elovl4 mouse models requires robust statistical approaches that can accommodate multiple variables and potential interactions:

  • For morphological and histological data:

    • ANOVA with post-hoc tests for comparisons across multiple genotypes or timepoints

    • Mixed-effects models for longitudinal studies with repeated measures

    • Quantitative image analysis using standardized parameters to reduce subjective bias

  • For molecular and biochemical measurements:

    • Multivariate analyses (PCA, cluster analysis) for lipidomic or transcriptomic datasets

    • Pathway enrichment analysis to identify affected biological processes

    • Correlation analyses to relate biochemical changes to phenotypic outcomes

  • For functional assessments (e.g., ERG for retinal function):

    • Repeated measures ANOVA for time-course data

    • Non-parametric tests when normality assumptions are violated

    • Regression models to identify predictors of functional outcomes

  • Sample size considerations:

    • Power analysis prior to experimentation to determine appropriate sample sizes

    • Consideration of sex as a biological variable

    • Appropriate handling of littermate controls to account for genetic background effects

  • Multiple testing corrections:

    • Bonferroni, Benjamini-Hochberg, or other appropriate corrections when performing multiple comparisons

    • Clear reporting of both raw and adjusted p-values

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.