Recombinant Mouse Elongation of very long chain fatty acids protein 6 (Elovl6)

Shipped with Ice Packs
In Stock

Description

Fatty Acid Metabolism

Elovl6 determines the balance between saturated and monounsaturated fatty acids, impacting membrane fluidity, lipid signaling, and metabolic pathways:

  • Knockout Effects: Elovl6/^{-/-} mice show elevated palmitate (C16:0) and reduced stearate (C18:0) and oleate (C18:1) levels in tissues .

  • Interaction Partners: Cooperates with stearoyl-CoA desaturase (SCD1) and other elongases (e.g., ELOVL1, ELOVL3) to regulate lipid composition .

Cellular Processes

  • Proliferation and Migration: Silencing Elovl6 reduces vascular smooth muscle cell (VSMC) proliferation and migration by upregulating p53/p21 and suppressing mTOR signaling .

  • Differentiation: Maintains VSMC contractile phenotype by regulating smooth muscle markers (e.g., SMα-actin, SM22α) .

Table 1: Key Phenotypic Changes in Elovl6 Knockout Models

Model SystemObserved EffectsCitation
Elovl6/^{-/-} miceReduced neointima formation post-vascular injury; improved insulin sensitivity
HCC cell linesDecreased tumor growth and Akt activation upon Elovl6 knockdown
MacrophagesAltered sphingolipid synthesis and reduced cholesterol esters

Therapeutic Potential

  • Cancer: Elovl6 promotes hepatocellular carcinoma (HCC) growth and is linked to poor prognosis . Inhibition reduces tumor proliferation and enhances chemotherapy efficacy .

  • Metabolic Disorders: Elovl6/^{-/-} mice resist diet-induced insulin resistance despite obesity, highlighting its role in metabolic syndrome .

Recombinant Applications

Recombinant Elovl6 is used to study lipid metabolism and disease mechanisms:

  • In Vitro Assays: Measures elongation activity using microsomal fractions or transfected cell lines .

  • Structural Studies: AlphaFold-predicted structures aid in understanding substrate binding and catalytic mechanisms .

Clinical and Experimental Relevance

  • Biomarker Potential: High Elovl6 expression correlates with aggressive cancers and cardiovascular pathologies .

  • Drug Targeting: Small-molecule inhibitors of Elovl6 are under investigation for metabolic and oncologic therapies .

Future Directions

  • Mechanistic Studies: Elucidate how Elovl6-driven lipid changes influence membrane dynamics (e.g., micropinocytosis in pancreatic cancer) .

  • Therapeutic Development: Optimize Elovl6 inhibitors for clinical trials in HCC and atherosclerosis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Elovl6; Face; Lce; Masr; Elongation of very long chain fatty acids protein 6; 3-keto acyl-CoA synthase Elovl6; ELOVL fatty acid elongase 6; ELOVL FA elongase 6; Fatty acyl-CoA elongase; Long chain fatty acid elongase; Myelin-associated SUR4 protein; Very long chain 3-ketoacyl-CoA synthase 6; Very long chain 3-oxoacyl-CoA synthase 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Elovl6
Target Protein Sequence
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR KPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSK APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY YALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLM YLSYLVLFCHFFFEAYIGKVKKATKAE
Uniprot No.

Target Background

Function
Elovl6 catalyzes the initial and rate-limiting step in the four-reaction long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process enables the addition of two carbon units to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. As a condensing enzyme, Elovl6 elongates fatty acids with 12, 14, and 16 carbons, exhibiting higher activity toward C16:0 acyl-CoAs. It catalyzes the synthesis of unsaturated C16 long-chain fatty acids and, to a lesser extent, C18:0 and those with low desaturation degrees. Elovl6 may participate in the production of saturated and monounsaturated VLCFAs of various chain lengths, which serve as precursors of membrane lipids and lipid mediators, involved in multiple biological processes.
Gene References Into Functions
  1. Elovl6 is a key factor linking dysregulated lipid metabolism to beta-cell dysfunction, islet inflammation, and beta-cell apoptosis in T2D, highlighting oleate as a potential contributor to beta-cell lipotoxicity. PMID: 28461456
  2. Data suggests that Elovl6 plays a crucial role in the proper development of the embryonic growth plate. PMID: 27467521
  3. The synergistic action of ChREBP and SREBP-1c is essential for maximal induction of Elovl6 expression in the liver. PMID: 27524233
  4. These findings indicate that Elovl6-mediated alterations in hepatic FA composition, particularly oleic acid (C18:1n-9), regulate hepatic cholesterol and bile acid handling, providing protection against hepatotoxicity and steatohepatitis. PMID: 26619823
  5. Elongation of Very Long Chain fatty acids 6 (Elovl6) is necessary for the thermogenic action of brown adipose tissue. PMID: 26628376
  6. Data, including findings from knockout mouse studies, confirm Elovl6 as the sole enzyme responsible for elongating palmitate to oleate; elongation of palmitoleate to vaccinate does not require Elovl6; deletion of Elovl6 does not prevent nonalcoholic fatty liver disease. PMID: 25281760
  7. Our findings suggest that Elovl6 could be involved in insulin secretory capacity per beta-cell and diabetes. PMID: 24938128
  8. Elovl6 deficiency leads to changes in fatty acid composition, induction of apoptosis, TGF-beta1 expression, and reactive oxygen species generation. PMID: 24113622
  9. Elovl6 is a critical modulator of atherogenic high-fat diet-induced inflammation, oxidative stress, and fibrosis in the liver. PMID: 22753171
  10. REVIEW: fatty acid metabolism and lipotoxicity; discussion of the role of Elovl6 in newly recognized aspects of metabolic regulation. PMID: 22266797
  11. Elovl6 in macrophages may contribute to foam cell formation and progression of atherosclerosis. PMID: 21817094
  12. Data indicates that this elongase is a lipogenic enzyme regulated by SREBP-1, playing a significant role in de novo synthesis of long-chain saturated and monounsaturated fatty acids in conjunction with fatty acid synthase and stearoyl-CoA desaturase. PMID: 12032166
  13. These data demonstrate that Elovl-6 is directly and primarily regulated by SREBP-1c. PMID: 18226595
  14. Changes in fatty acid composition due to Elovl-6 are a decisive factor for gene expression related to energy metabolism and lifestyle-associated disorders. (review) PMID: 18810844
  15. Studies suggest that inhibition of ELOVL6 could be a novel therapeutic approach for the treatment of insulin resistance, diabetes, cardiovascular disease, and other metabolic disorders. PMID: 19259639

Show More

Hide All

Database Links
Protein Families
ELO family, ELOVL6 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in adrenal gland, liver, white adipose tissue (WAT), adult and fetal brain, cerebellum, spinal cord, testis, skin and peripheral nerve; where lipogenesis and steroidogenesis are active. Weakly expressed in kidney, heart, skeletal muscle,

Q&A

What is the primary function of Elovl6 in cellular metabolism?

Elovl6 is a rate-limiting enzyme that catalyzes the elongation of C16 saturated and monounsaturated fatty acids (FAs) to form C18 FAs. Specifically, it controls the conversion of palmitate (C16:0) to stearate (C18:0) and palmitoleate (C16:1) to vaccenate (C18:1), establishing a critical checkpoint in fatty acid metabolism. This elongation activity directly influences the ratio of C16 to C18 fatty acids in cellular membranes and storage lipids, affecting membrane fluidity, lipid droplet formation, and downstream lipid-derived signaling molecules . The enzyme's activity is particularly important in tissues with high rates of de novo lipogenesis, such as the liver, where it helps regulate the fatty acid composition in response to nutritional status.

How is Elovl6 expression regulated in different tissues?

Elovl6 expression exhibits tissue-specific patterns with highest expression observed in the liver, adipose tissue, brain, and pancreatic β-cells. Its expression is predominantly regulated by:

  • Transcription factors: SREBP-1c (sterol regulatory element binding protein-1c) and ChREBP (carbohydrate-responsive element-binding protein) are major transcriptional activators of Elovl6 during high carbohydrate intake or insulin stimulation .

  • Nutritional status: High-carbohydrate diets and insulin signaling upregulate Elovl6, while fasting conditions generally decrease its expression.

  • Inflammatory mediators: In pathological conditions like multiple sclerosis, myelin internalization by phagocytes significantly increases Elovl6 expression, particularly after prolonged (72h) exposure to myelin .

  • Metabolic stress: Obesity and insulin resistance can dysregulate Elovl6 expression, contributing to metabolic disturbances.

For accurate quantification of Elovl6 expression across tissues, quantitative PCR with well-validated primers is recommended, with normalization to stable reference genes appropriate for the tissue type under investigation.

What phenotypic changes occur in Elovl6 knockout mouse models?

Elovl6 knockout (Elovl6^-/-) mice exhibit several characteristic phenotypic changes:

Phenotypic ParameterElovl6^-/- PhenotypeFunctional Significance
Fatty acid compositionIncreased C16:0 and C16:1; decreased C18:0 and C18:1Altered membrane properties and lipid metabolism
Insulin sensitivityProtected against obesity-induced insulin resistancePotential therapeutic target for metabolic disorders
Response to high-fat dietObesity still occurs but with improved glucose toleranceDissociation between obesity and insulin resistance
Neointima formationMarkedly inhibited following vascular injuryImplication in vascular remodeling processes
Response to diabetes (db/db background)Improved hyperglycemia and insulin secretory capacityProtection against pancreatic β-cell dysfunction

Notably, Elovl6 knockout mice show protection against metabolic disorders even when obesity persists, highlighting the critical role of fatty acid composition rather than simply lipid quantity in metabolic homeostasis . The improved insulin sensitivity occurs through altered ceramide synthesis, particularly reduced C18:0-ceramide production, which otherwise activates protein phosphatase 2A (PP2A) and impairs insulin signaling .

What are the optimal conditions for studying Elovl6 enzymatic activity in vitro?

Accurately measuring Elovl6 enzymatic activity requires careful experimental design:

Recommended protocol:

  • Microsomal preparation: Isolate microsomes from tissues of interest or recombinant expression systems using differential centrifugation (10,000×g to remove nuclei and mitochondria, followed by 100,000×g to pellet microsomes).

  • Reaction mixture components:

    • Microsomal protein (50-100 μg)

    • Palmitoyl-CoA or palmitoleoyl-CoA substrate (50-100 μM)

    • Malonyl-CoA (50-100 μM) as the 2-carbon donor

    • NADPH (1-2 mM) for redox reactions

    • ATP (5 mM) and CoA (200 μM)

    • Buffer: 50 mM Tris-HCl (pH 7.4), 150 mM NaCl, 2 mM DTT

  • Reaction conditions: Incubate at 37°C for 30-60 minutes in a shaking water bath.

  • Analysis methods:

    • LC-ESI/MS/MS (liquid chromatography-electrospray ionization tandem mass spectrometry) for direct measurement of C16/C18 elongation ratios

    • Incorporation of radiolabeled substrates (e.g., [14C]-malonyl-CoA) followed by thin-layer chromatography

  • Validation: Include control reactions with known Elovl6 inhibitors (e.g., ELOVL6-IN-2) to confirm specificity.

This assay requires optimization for specific tissue types, as the optimal pH and cofactor concentrations may vary slightly depending on the source of Elovl6.

How can researchers effectively knock down or inhibit Elovl6 in experimental models?

Multiple approaches exist for inhibiting Elovl6 function in experimental settings:

Genetic approaches:

  • Global knockout: Complete deletion of Elovl6 gene using conventional knockout strategies has been successful in mice, producing viable animals with altered fatty acid profiles and metabolic phenotypes .

  • Conditional/tissue-specific knockout: Utilizing Cre-loxP systems, liver-specific Elovl6 knockout (LKO) mice have been generated to study tissue-specific effects. This approach revealed distinct phenotypes compared to global knockouts, particularly when mice were challenged with different diets .

  • siRNA/shRNA-mediated knockdown: For cell culture models, siRNAs targeting Elovl6 mRNA effectively reduce expression. For long-term studies, shRNA approaches provide more sustained knockdown. Transfection efficiency should be monitored and validated via qPCR and Western blot .

  • CRISPR-Cas9 gene editing: Complete knockout of Elovl6 in cell lines using CRISPR-Cas9 has been demonstrated to abolish enzyme activity, with confirmation by sequencing and functional assays .

Pharmacological approaches:

  • Small molecule inhibitors: ELOVL6-IN-2 has been identified as a specific inhibitor of Elovl6 activity. Effective concentrations typically range from 1-10 μM in cell culture systems .

  • Verification of target engagement: Measure changes in C16:C18 fatty acid ratios using gas chromatography-mass spectrometry (GC-MS) or LC-MS/MS to confirm effective Elovl6 inhibition.

The choice of approach depends on the specific research question, with genetic approaches offering high specificity but requiring more extensive validation, while pharmacological approaches provide temporal control but may have off-target effects that need careful assessment.

How does Elovl6 inhibition affect remyelination in multiple sclerosis models?

Elovl6 has emerged as a potential therapeutic target for promoting remyelination in multiple sclerosis (MS). Recent findings demonstrate that:

  • Elovl6 expression in MS lesions: Elovl6 is significantly upregulated in CD68+ phagocytes (macrophages and microglia) within active MS lesions, particularly in the lesion center compared to the rim and normal-appearing white matter (NAWM) .

  • Functional consequences of Elovl6 deficiency:

    • Elovl6-deficient macrophages exhibit enhanced intracellular processing of myelin-derived lipids

    • Altered lipid composition in Elovl6-deficient phagocytes shifts them toward a more reparative phenotype

    • This phenotypic change promotes remyelination in demyelinated lesions

  • Mechanistic pathway:

    • Elovl6 deficiency alters saturated:monounsaturated fatty acid (SFA:MUFA) ratios in multiple lipid classes

    • Reduced cholesterol ester levels in Elovl6-deficient macrophages

    • Increased sphingolipid synthesis, including sphingomyelins, dihydroceramides, and hexosylceramides

    • These changes affect membrane biophysical properties, including intrinsic curvature, lateral diffusion, and transition temperature

  • Experimental approach for studying remyelination:

    • Use cuprizone or lysolecithin-induced demyelination models in Elovl6^-/- mice

    • Monitor oligodendrocyte progenitor cell recruitment and differentiation using immunohistochemistry for NG2, PDGFRα, and mature markers (MBP, PLP)

    • Quantify remyelination using electron microscopy to assess g-ratio (axon diameter:total fiber diameter ratio)

    • Use ex vivo cerebellar slice cultures to study remyelination dynamics in controlled conditions

The data indicate that targeting Elovl6 represents a potential strategy for developing reparative therapies that could promote remyelination rather than just managing symptoms or slowing disease progression in MS .

What is the relationship between Elovl6 activity and insulin resistance in metabolic disease models?

Elovl6 plays a critical role in the development of insulin resistance, with complex tissue-specific effects:

  • Global Elovl6 deficiency effects:

    • Elovl6^-/- mice are protected against obesity-induced insulin resistance despite developing similar levels of hepatosteatosis and obesity as wild-type mice

    • When crossed with leptin receptor-deficient db/db mice, Elovl6 deficiency significantly improves hyperglycemia and increases insulin secretory capacity

  • Tissue-specific effects:

    • Liver: Liver-specific Elovl6 knockout (LKO) mice show distinct phenotypes depending on dietary challenge:

      • No improvement in insulin resistance on high-fat/high-sucrose (HFHS) diet

      • Enhanced insulin sensitivity when fed high-sucrose diet (HSD) through improved hepatic insulin signaling via Akt

    • Pancreatic β-cells: Elovl6 deficiency improves β-cell function and insulin secretion in db/db mice, preventing progression to type 2 diabetes mellitus (T2DM)

  • Molecular mechanisms:

PathwayEffect of Elovl6 DeficiencyPhysiological Outcome
Ceramide synthesisReduced C18:0-ceramide productionDecreased PP2A activation and enhanced insulin signaling
Membrane compositionAltered C16:C18 fatty acid ratioChanges in membrane fluidity and insulin receptor signaling
Inflammatory signalingReduced inflammatory mediatorsImproved insulin sensitivity
ER stressAttenuated ER stress responseEnhanced β-cell function and survival
  • Human relevance:

    • Genetic variations in the ELOVL6 gene are associated with risk of T2DM in human populations

    • Changes in fatty acid composition, particularly the C16:C18 ratio, appear to be critical determinants of insulin sensitivity independent of total lipid accumulation

These findings highlight Elovl6 as a metabolic checkpoint that could be targeted therapeutically for the treatment of insulin resistance and T2DM, acting through mechanisms that are independent of obesity itself.

How does Elovl6 inhibition affect membrane properties and drug permeability in cancer cells?

Recent research has identified Elovl6 as a promising therapeutic target in cancer, particularly in pancreatic ductal adenocarcinoma (PDAC), with significant effects on membrane properties and drug response:

  • Effects on cancer cell proliferation:

    • Elovl6 interference through knockdown or pharmacological inhibition consistently reduces proliferation across multiple PDAC cell lines

    • Complete knockout of Elovl6 using CRISPR-Cas9 significantly reduces colony formation capacity

  • Membrane biophysical changes:

    • Elovl6 inhibition results in:

      • Increased membrane flexibility and reduced rigidity

      • Higher variability in cell shape

      • Reduced membrane tension

      • Significant changes in membrane permeability

  • Impact on drug uptake and efficacy:

    • Enhanced permeability following Elovl6 interference increases uptake of chemotherapeutic agents

    • Specifically, improved uptake of Flutax-2 (a fluorescent taxol derivative) was observed in PDAC cell lines with Elovl6 inhibition

    • This suggests potential for Elovl6 inhibition as a chemosensitization strategy

  • Mechanistic basis:

    • Changes in fatty acid elongation directly affect membrane lipid composition

    • Altered ratio of C16:C18 fatty acids impacts membrane fluidity and permeability

    • These biophysical changes facilitate increased uptake of therapeutic compounds

    • Effects appear to be specific to Elovl6 inhibition rather than general disruption of fatty acid metabolism

For researchers investigating Elovl6 in cancer contexts, measurements of membrane fluidity using fluorescence anisotropy with DPH (1,6-diphenyl-1,3,5-hexatriene) probes and assessment of drug uptake through fluorescent drug analogs are recommended methodological approaches .

What role does Elovl6 play in vascular smooth muscle cell (VSMC) phenotypic switching?

Elovl6 has been identified as an important regulator of vascular smooth muscle cell (VSMC) phenotype and function:

  • Effects on neointima formation:

    • Neointima formation following wire injury is markedly inhibited in Elovl6^-/- mice

    • Cultured VSMCs with siRNA-mediated knockdown of Elovl6 show substantially reduced responsiveness to platelet-derived growth factor-BB (PDGF-BB), a key driver of VSMC proliferation and migration

  • Molecular mechanisms:

    • Elovl6 inhibition induces cell cycle suppressors p53 and p21

    • Reduces mammalian target of rapamycin (mTOR) phosphorylation

    • Alters VSMC marker expression

    • These changes are attributed to:

      • Increased palmitate levels and reduced oleate levels

      • Enhanced reactive oxygen species (ROS) production

      • Activation of AMP-activated protein kinase (AMPK)

  • Pluripotency gene induction:

    • Elovl6 inhibition robustly induces Krüppel-like factor 4 (KLF4) expression in VSMCs

    • KLF4 knockdown significantly attenuates AMPK-induced phenotypic switching

    • This establishes KLF4 as a critical downstream mediator of Elovl6's effects on VSMC phenotype

  • Experimental approaches for studying VSMC phenotype:

    • Wire injury models in Elovl6^-/- mice to assess in vivo relevance

    • Cell culture models with siRNA knockdown or pharmacological inhibition

    • Analysis of proliferation, migration, and expression of VSMC markers (α-SMA, SM22α, calponin)

    • Assessment of signaling pathway activation (AMPK, mTOR, p53/p21)

    • Measurement of fatty acid composition and ROS production

These findings suggest that targeting Elovl6 could represent a novel therapeutic approach for preventing pathological vascular remodeling in conditions such as atherosclerosis and restenosis after angioplasty .

What are the common challenges in measuring fatty acid composition changes following Elovl6 manipulation?

Accurately quantifying changes in fatty acid composition after Elovl6 manipulation requires attention to several technical challenges:

  • Sample preparation issues:

    • Lipid oxidation during processing can alter fatty acid profiles

    • Incomplete extraction may bias results toward certain lipid classes

    • Differential recovery of fatty acids based on chain length and saturation

  • Recommended protocol for fatty acid analysis:

    • Extract total lipids using Bligh and Dyer or Folch methods with antioxidants (BHT) added

    • For comprehensive analysis, separate lipid classes using thin-layer chromatography or solid-phase extraction

    • Transmethylate fatty acids using acid or base catalysis (select based on lipid class)

    • Analyze fatty acid methyl esters by gas chromatography with flame ionization detection (GC-FID) or GC-MS

    • For complex lipid analysis, use LC-MS/MS with appropriate internal standards

  • Critical quality control measures:

    • Include known fatty acid standards covering C16-C18 range

    • Use internal standards for each major fatty acid class

    • Validate extraction efficiency with spiked samples

    • Perform technical replicates to ensure analytical precision

    • Consider biological variability, especially in primary tissues

  • Data interpretation considerations:

    • Focus on relative changes in C16:C18 ratios rather than absolute concentrations

    • Analyze both free fatty acids and complex lipids (phospholipids, triglycerides, etc.)

    • Consider changes in desaturation indices alongside elongation

    • Account for diet-induced changes in tissue fatty acid composition

How can researchers reconcile contradictory findings on Elovl6 function in different tissues or disease models?

Apparent contradictions in Elovl6 research findings often stem from context-dependent functions and methodological differences:

Research ContextObserved Elovl6 EffectPotential Mechanistic Explanation
Metabolic diseaseBeneficial effects of inhibitionReduced ceramide production improves insulin signaling
Multiple sclerosisBeneficial effects of inhibitionChanged phagocyte phenotype promotes remyelination
Vascular diseaseBeneficial effects of inhibitionROS-mediated AMPK activation inhibits VSMC proliferation
CancerVariable effects depending on cancer typeCell-type specific requirements for membrane composition
  • Recommendation for resolving contradictions:

    • Perform side-by-side comparisons using standardized methods

    • Validate key findings across multiple experimental systems

    • Consider temporal aspects of Elovl6 function (acute vs. chronic manipulation)

    • Account for compensatory mechanisms that may emerge in genetic models

Understanding the context-dependent nature of Elovl6 function is crucial for correctly interpreting seemingly contradictory results and for developing targeted therapeutic approaches .

What are promising therapeutic applications for Elovl6 modulation beyond current research models?

Based on current understanding of Elovl6 biology, several promising therapeutic applications warrant further investigation:

  • Neurodegenerative disorders:

    • Beyond multiple sclerosis, Elovl6 modulation may be relevant for other neurodegenerative conditions

    • Altered lipid metabolism is implicated in Alzheimer's and Parkinson's diseases

    • Elovl6 inhibition could potentially influence neuroinflammation and microglial activation

  • Cardiovascular disease prevention:

    • Given the effects on VSMC phenotype and neointima formation, Elovl6 inhibitors could be developed for:

      • Prevention of restenosis after angioplasty

      • Reduction of atherosclerotic plaque progression

      • Modulation of cardiac remodeling following myocardial infarction

  • Combination therapy for cancer:

    • Elovl6 inhibition sensitizes cancer cells to chemotherapy through membrane permeability changes

    • Development of dual-targeting approaches combining Elovl6 inhibitors with:

      • Standard chemotherapeutics (particularly taxanes)

      • Targeted therapies that may benefit from enhanced cellular uptake

      • Immunotherapies where lipid metabolism affects immune cell function

  • Metabolic syndrome and non-alcoholic steatohepatitis (NASH):

    • Elovl6 modulation offers potential to address multiple components of metabolic syndrome

    • Beyond improving insulin sensitivity, it may reduce inflammation and fibrosis in NASH

    • Could provide benefits independent of weight loss, addressing a major challenge in treating obesity-related disorders

  • Innovative delivery strategies:

    • Tissue-specific targeting of Elovl6 inhibitors using nanoparticles

    • Temporal control of inhibition to minimize potential side effects

    • Combination with dietary interventions to optimize fatty acid profiles

These applications would benefit from further development of specific, potent Elovl6 inhibitors with favorable pharmacokinetic profiles, as well as advanced in vivo models to validate efficacy and safety.

What methodological advances are needed to better understand the role of Elovl6 in tissue-specific contexts?

Advancing Elovl6 research requires several methodological innovations:

  • Improved tissue-specific and temporal control:

    • Development of inducible, cell type-specific Elovl6 knockout models

    • CRISPR-Cas9 systems with tissue-specific promoters for in vivo editing

    • Optogenetic or chemogenetic control of Elovl6 expression for temporal precision

  • Advanced imaging techniques:

    • Live-cell imaging of fatty acid trafficking using fluorescent fatty acid analogs

    • Correlative light and electron microscopy to visualize Elovl6-associated membrane domains

    • Mass spectrometry imaging to map fatty acid composition changes in tissues with spatial resolution

  • Single-cell analysis approaches:

    • Single-cell lipidomics to understand cellular heterogeneity in fatty acid elongation

    • Integration with single-cell transcriptomics to correlate Elovl6 expression with fatty acid profiles

    • Spatial transcriptomics to map Elovl6 expression patterns in complex tissues

  • Improved pharmacological tools:

    • Development of highly selective Elovl6 inhibitors with improved pharmacokinetics

    • Activity-based probes to monitor Elovl6 enzymatic activity in situ

    • Photocrosslinking approaches to identify Elovl6 protein interactors in different contexts

  • Systems biology frameworks:

    • Computational models of fatty acid metabolism incorporating Elovl6 activity

    • Multi-omics data integration approaches to understand tissue-specific consequences

    • Network analysis to identify key nodes interacting with Elovl6 across different pathological contexts

These methodological advances would significantly enhance our understanding of how Elovl6 functions in different tissues and disease states, potentially uncovering new therapeutic applications and mechanistic insights .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.