Recombinant Mouse Elongation of very long chain fatty acids protein 7 (Elovl7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Elongation of Very Long Chain Fatty Acids Protein 7 (Elovl7)

Recombinant Mouse Elongation of Very Long Chain Fatty Acids Protein 7 (Elovl7) is a genetically engineered form of the Elovl7 enzyme, which plays a crucial role in the elongation of very long-chain fatty acids (VLCFAs). VLCFAs are essential components in the synthesis of ceramides and sphingolipids, which are vital for various cellular functions, including nerve, skin, and retina health . The recombinant version of this enzyme is produced through biotechnological methods, allowing for its use in research and potential therapeutic applications.

Function and Structure of Elovl7

Elovl7 is part of the ELOVL family of elongases, which are integral membrane enzymes located in the endoplasmic reticulum. These enzymes catalyze the first step in the fatty acid elongation cycle by condensing acyl-CoA with malonyl-CoA to form 3-ketoacyl-CoA, a key intermediate in VLCFA synthesis . The structure of human Elovl7 has been resolved to a resolution of 2.6 Å, revealing an inverted transmembrane barrel structure with a 35 Å long tunnel that contains substrate-binding sites and an active site deep within the membrane .

Disease Association

Elovl7 has been implicated in various diseases, including insulin resistance, hepatic steatosis, and Parkinson's disease, due to its role in VLCFA metabolism . Additionally, Elovl7 expression is associated with liver fibrosis and inflammation, suggesting its potential as a biomarker for liver diseases .

Therapeutic Potential

The ELOVL elongases, including Elovl7, are potential therapeutic targets for conditions characterized by VLCFA accumulation, such as X-linked adrenoleukodystrophy . Understanding the molecular mechanisms of Elovl7 could lead to the development of selective inhibitors for treating these diseases.

Expression and Purification

Recombinant Elovl7 can be expressed in various cell lines, such as insect (Sf9) and mammalian (Expi293F) cells, and purified using specific detergents and lipid combinations . The purified enzyme often includes a covalently attached 3-keto acyl-CoA, which enhances its stability.

Expression and Purification Data

Expression SystemPurification MethodConcentration Achieved
Insect (Sf9) cellsOGNG with CHS10-25 mg/ml
Mammalian (Expi293F) cellsOGNG with CHS10-25 mg/ml

Disease Association Data

DiseaseAssociationReference
Liver FibrosisELOVL7 upregulation is associated with advanced liver fibrosis (OR = 11.8)
X-linked AdrenoleukodystrophyELOVL elongases are potential therapeutic targets for VLCFA accumulation diseases

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, briefly centrifuge the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development accordingly.
Synonyms
Elovl7; Elongation of very long chain fatty acids protein 7; 3-keto acyl-CoA synthase Elovl7; ELOVL fatty acid elongase 7; ELOVL FA elongase 7; Very long chain 3-ketoacyl-CoA synthase 7; Very long chain 3-oxoacyl-CoA synthase 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Elovl7
Target Protein Sequence
MAFSDLTSRTVRFYDNWIKDADPRVEDYLLMSSPLPQTIILGLYVYFVTSLGPKLMENRK PFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLY YFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAV HVVMYSYYGLCAMGPAYQKYLWWKKHLTSLQLVQFVLVTIHIGQIFFMEDCNYQYPVFLY IIMSYGCIFLLLFLHFWYRAYTKGQRLPKTLENGNCKSKRH
Uniprot No.

Target Background

Function
Elovl7 catalyzes the initial and rate-limiting step within the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process enables the addition of two carbon units to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Elovl7 exhibits higher activity towards C18 acyl-CoAs, particularly C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. It also demonstrates activity towards C20:4-, C18:0-, C18:1-, C18:2-, and C16:0-CoAs, and weak activity towards C20:0-CoA. Minimal or no activity is observed towards C22:0-, C24:0-, or C26:0-CoAs. Elovl7 may play a role in the production of saturated and polyunsaturated VLCFAs with varying chain lengths that are involved in various biological processes. These VLCFAs serve as precursors for membrane lipids and lipid mediators.
Database Links
Protein Families
ELO family, ELOVL7 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of mouse ELOVL7 and how does it compare to human ELOVL7?

Mouse ELOVL7, like its human counterpart, is expected to contain seven transmembrane (TM) helices with TM2-7 forming an inverted barrel surrounding a narrow tunnel. The human ELOVL7 structure, solved by X-ray crystallography to 2.6 Å resolution, reveals that the protein crystallizes as a head-to-tail dimer with a small and unconserved interaction surface . The transmembrane barrel structure contains a 35-Å long tunnel that houses the substrate binding sites .

To compare mouse and human ELOVL7 structures:

  • Use sequence alignment tools to identify conserved residues between species

  • Generate homology models of mouse ELOVL7 based on the human crystal structure (PDB: 6Y7F)

  • Analyze conservation of the active site residues, particularly the canonical HxxHH motif and other residues involved in substrate recognition

  • Perform molecular dynamics simulations to evaluate structural stability and substrate interaction differences

The high conservation of ELOVL elongases across species suggests that mouse ELOVL7 likely shares the fundamental structural features observed in human ELOVL7, making recombinant mouse ELOVL7 a valuable model for studying elongase function .

How is ELOVL7 expression regulated in different mouse tissues?

Understanding the tissue-specific expression of ELOVL7 is crucial for interpreting its physiological functions. While specific information about mouse ELOVL7 tissue distribution is limited in the provided search results, general methodological approaches to determine expression patterns include:

  • Quantitative RT-PCR analysis of Elovl7 mRNA across multiple mouse tissues

  • Western blot analysis using anti-ELOVL7 antibodies to detect protein levels

  • Immunohistochemistry to visualize tissue and cellular localization

  • Single-cell RNA sequencing to identify cell types expressing Elovl7

  • Analysis of promoter regions to identify tissue-specific regulatory elements

Based on studies of human ELOVL7 and related elongases, expression is likely regulated by transcription factors involved in lipid metabolism, including sterol regulatory element-binding proteins (SREBPs) and peroxisome proliferator-activated receptors (PPARs). Researchers should design experiments to investigate these regulatory mechanisms specifically in mouse models .

What are the optimal conditions for expressing and purifying functional recombinant mouse ELOVL7?

Expressing and purifying membrane proteins like ELOVL7 presents significant technical challenges. Based on successful approaches with human ELOVL7, the following methodology is recommended:

  • Expression system selection:

    • Use insect cells (Sf9 or Hi5) with baculovirus expression system

    • Alternatively, mammalian expression systems (HEK293 or CHO cells) may preserve mammalian post-translational modifications

  • Construct design:

    • Include an N-terminal purification tag (e.g., His6, FLAG, or Twin-Strep)

    • Consider adding a fluorescent protein fusion to monitor expression

    • Include a tobacco etch virus (TEV) protease cleavage site for tag removal

  • Membrane extraction and solubilization:

    • Use mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or OGNG (octyl glucose neopentyl glycol) as used for human ELOVL7

    • Optimize detergent-to-protein ratio to maintain protein stability and activity

  • Purification protocol:

    • Immobilized metal affinity chromatography (IMAC) as primary purification

    • Size exclusion chromatography to separate aggregates and dimers

    • Verify purity by SDS-PAGE and protein identity by mass spectrometry

  • Activity verification:

    • Assess structural integrity using circular dichroism spectroscopy

    • Confirm enzymatic activity using in vitro elongation assays with C18:0-CoA and malonyl-CoA substrates

For quality control, intact mass spectrometry can be performed using similar methods to those described for human ELOVL7, including an Agilent 1290 Infinity LC system coupled to an Agilent 6550 QTOF mass spectrometer .

How can researchers design experiments to investigate the catalytic mechanism of mouse ELOVL7?

Based on human ELOVL7 studies, the elongation reaction proceeds via an acyl-enzyme intermediate involving the second histidine (H150) in the canonical HxxHH motif . To investigate this mechanism in mouse ELOVL7:

  • Site-directed mutagenesis:

    • Generate alanine substitutions of the conserved histidines in the HxxHH motif

    • Create mutants of other potentially important residues (D130, N177, H181, Q214 in human ELOVL7)

    • Assess activity of mutants using in vitro elongation assays

  • Reaction intermediate trapping:

    • Incubate purified enzyme with C18:0-CoA at 37°C for 2 hours

    • Include conditions with and without EDTA, EGTA, or malonyl-CoA

    • Analyze by intact mass spectrometry to detect covalent acyl-enzyme intermediates

    • Compare with expected mass shifts for acyl adducts to confirm mechanism

  • Structural studies:

    • Attempt co-crystallization with substrate analogs or reaction intermediates

    • Use cryo-EM as an alternative approach for structural determination

    • Employ molecular dynamics simulations to model reaction progression

  • Kinetic analysis:

    • Design experiments to test ping-pong (bi-bi) kinetic mechanism

    • Vary both acyl-CoA and malonyl-CoA concentrations in activity assays

    • Analyze data using Lineweaver-Burk or Hanes-Woolf plots to distinguish between sequential and ping-pong mechanisms

This methodological approach will help elucidate whether mouse ELOVL7 employs the same catalytic mechanism as human ELOVL7, involving an unusual acyl-imidazole intermediate .

What are the most effective methods to study the role of ELOVL7 in necroptosis pathways?

ELOVL7 knockdown has been shown to reduce cell death and membrane permeabilization during necroptosis, a form of programmed cell death . To investigate this connection:

  • Gene silencing approaches:

    • Design siRNA or shRNA specific to mouse Elovl7

    • Create CRISPR-Cas9 knockout cell lines and mouse models

    • Validate knockdown/knockout efficiency by qRT-PCR and western blot

  • Necroptosis induction and assessment:

    • Treat cells with TNF-α plus SMAC mimetic and caspase inhibitor (TSZ treatment)

    • Assess cell death using propidium iodide staining and flow cytometry

    • Measure membrane permeabilization with LDH release assays

    • Evaluate morphological changes using time-lapse microscopy

  • Lipidomic analysis:

    • Extract lipids from ELOVL7-deficient and control cells

    • Perform liquid chromatography-mass spectrometry to identify alterations in VLCFA profiles

    • Focus on ceramides and sphingolipids that may mediate necroptotic signaling

  • Mechanistic studies:

    • Analyze the phosphorylation status of RIPK1, RIPK3, and MLKL

    • Assess mitochondrial dysfunction using membrane potential indicators

    • Examine the formation of the necrosome complex via co-immunoprecipitation

    • Evaluate rescue experiments with specific VLCFA species

  • In vivo validation:

    • Generate tissue-specific Elovl7 knockout mice

    • Challenge with necroptosis-inducing stimuli (e.g., TNF-α)

    • Assess tissue damage and inflammatory responses

This comprehensive approach will help delineate the specific mechanisms by which ELOVL7 and its products contribute to necroptotic cell death pathways .

How should researchers design structure-function studies to understand substrate specificity determinants of mouse ELOVL7?

The crystal structure of human ELOVL7 reveals a substrate-binding tunnel that likely determines substrate specificity . To investigate specificity determinants in mouse ELOVL7:

  • Comparative sequence analysis:

    • Align sequences of ELOVL family members with different specificities

    • Identify non-conserved residues lining the substrate tunnel

    • Create a conservation map based on the human ELOVL7 structure

  • Chimeric protein design:

    • Construct chimeras between ELOVL7 and other ELOVL family members

    • Focus on regions lining the substrate tunnel

    • Express, purify, and characterize the chimeric proteins

  • Site-directed mutagenesis strategy:

    • Target non-conserved residues lining the substrate tunnel

    • Create single and multiple amino acid substitutions

    • Design mutations that alter the tunnel dimensions or physicochemical properties

  • Activity assays with diverse substrates:

    • Test wild-type and mutant enzymes with various acyl-CoA substrates

    • Vary carbon chain length (C16-C24) and saturation (saturated, mono-, and polyunsaturated)

    • Determine kinetic parameters for each enzyme-substrate combination

  • Structural validation:

    • Attempt to crystallize key mutants or chimeras

    • Perform molecular docking of different substrates

    • Use molecular dynamics simulations to analyze substrate-protein interactions

This systematic approach will help identify the structural features of mouse ELOVL7 that determine its preference for C18 acyl-CoAs, particularly C18:3(n-3) and C18:3(n-6) .

What approaches can be used to investigate the dimerization and membrane topology of ELOVL7?

Human ELOVL7 crystallizes as a head-to-tail dimer with seven transmembrane helices . To study these features in mouse ELOVL7:

  • Assess dimerization state:

    • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Blue native PAGE to analyze native complexes

    • Chemical crosslinking followed by SDS-PAGE and western blotting

    • Fluorescence resonance energy transfer (FRET) between differently tagged ELOVL7 monomers

  • Investigate membrane topology:

    • Cysteine accessibility assays using membrane-permeable and -impermeable sulfhydryl reagents

    • Protease protection assays to identify cytoplasmic and luminal domains

    • Fluorescence protease protection (FPP) assay with GFP-tagged constructs

    • Glycosylation mapping using N-glycosylation site insertions

  • Dimer interface analysis:

    • Site-directed mutagenesis of residues at the predicted dimer interface

    • Disulfide crosslinking of engineered cysteines at the interface

    • Assess the impact of dimerization disruption on enzyme activity

  • Functional significance of dimerization:

    • Create obligate monomers using interface mutations

    • Develop covalently linked dimers with flexible linkers

    • Compare enzymatic activities of monomeric and dimeric forms

This multifaceted approach will help determine whether dimerization is essential for mouse ELOVL7 function and identify key structural elements involved in maintaining the correct membrane topology .

How can researchers investigate the potential role of ELOVL7 in neurological disorders?

ELOVL7 has been implicated in early-onset Parkinson's disease . To explore its role in neurological disorders:

  • Expression analysis in neural tissues:

    • Quantify Elovl7 expression in different brain regions using qRT-PCR

    • Perform immunohistochemistry to localize ELOVL7 in neuronal and glial populations

    • Compare expression levels between normal and disease model brains

  • Lipidomic analysis of neural tissues:

    • Extract lipids from specific brain regions

    • Identify VLCFA species using targeted lipidomics

    • Compare lipid profiles between wild-type and Elovl7-deficient mice

  • Generation of neuronal models:

    • Create Elovl7 knockdown/knockout in neuronal cell lines

    • Differentiate Elovl7-deficient iPSCs into neurons

    • Develop conditional knockout mice with neuron-specific Elovl7 deletion

  • Functional assessments:

    • Evaluate mitochondrial function using respiratory capacity measurements

    • Assess oxidative stress levels with ROS-sensitive dyes

    • Examine α-synuclein aggregation and phosphorylation

    • Measure neurite outgrowth and synaptic density

  • Behavioral studies in mouse models:

    • Perform motor function tests (rotarod, grip strength, open field)

    • Assess cognitive function using maze tests

    • Evaluate dopaminergic system integrity with neurochemical analyses

  • Therapeutic intervention studies:

    • Test ELOVL7 inhibitors in cellular and animal models

    • Supplement with specific downstream lipid products

    • Evaluate neuroprotective effects and mechanisms

This comprehensive approach will help determine the specific mechanisms by which ELOVL7 dysfunction contributes to neurological disorders and may identify potential therapeutic targets .

What are the key considerations for designing inhibitors of mouse ELOVL7?

The unique structure of ELOVL7 with its substrate binding tunnel and catalytic mechanism presents opportunities for selective inhibitor design:

  • Structure-based approaches:

    • Target the acyl-CoA binding tunnel

    • Design compounds that mimic the transition state of the condensation reaction

    • Focus on interactions with the catalytic histidine residues in the HxxHH motif

  • Screening methodologies:

    • Develop high-throughput enzymatic assays measuring elongation activity

    • Use thermal shift assays to identify compounds that stabilize the protein

    • Employ surface plasmon resonance to measure binding kinetics

  • Selectivity considerations:

    • Design inhibitors that exploit non-conserved residues between ELOVL family members

    • Test compounds against multiple ELOVL enzymes to assess specificity

    • Evaluate off-target effects on other fatty acid metabolizing enzymes

  • In silico approaches:

    • Perform virtual screening against the substrate tunnel

    • Use molecular dynamics to assess binding stability

    • Apply quantum mechanical calculations to evaluate covalent inhibitor mechanisms

  • Cellular validation:

    • Measure changes in cellular VLCFA profiles

    • Assess effects on lipid metabolism pathways

    • Determine cytotoxicity and specificity in relevant cell types

The unusual substrate-binding arrangement and chemistry of ELOVL7 suggest mechanisms for selective inhibition, which could be relevant for diseases where VLCFAs accumulate, such as X-linked adrenoleukodystrophy .

How should researchers analyze and interpret data from ELOVL7 knockout or knockdown experiments?

When conducting ELOVL7 loss-of-function studies, consider these methodological approaches:

  • Validation of knockout/knockdown:

    • Confirm gene deletion/silencing at the DNA level using PCR

    • Verify reduced mRNA expression by qRT-PCR

    • Demonstrate protein reduction via western blot

    • Functional validation through elongase activity assays

  • Lipidomic analysis:

    • Comprehensive profiling of fatty acids and complex lipids

    • Focus on expected substrates (C16-C20) and products (C18-C22)

    • Analyze acyl chain composition of phospholipids, sphingolipids, and neutral lipids

    • Compare results with theoretical predictions based on ELOVL7 substrate preferences

  • Phenotypic characterization:

    • Assess cellular morphology and viability

    • Evaluate membrane properties and fluidity

    • Examine organelle structure and function, particularly the ER

    • Test sensitivity to necroptotic stimuli based on ELOVL7's role in this pathway

  • Compensation analysis:

    • Measure expression changes in other ELOVL family members

    • Evaluate alterations in related lipid metabolic pathways

    • Consider adaptive responses that may mask primary effects

  • Data interpretation guidelines:

    • Distinguish direct effects from secondary consequences

    • Consider context-dependent functions in different tissues

    • Account for potential developmental compensation in knockout models

    • Integrate findings with existing knowledge of VLCFA metabolism

This systematic approach ensures rigorous analysis of ELOVL7 function while accounting for the complexity of lipid metabolism networks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.