Recombinant Mouse Endoplasmic reticulum-Golgi intermediate compartment protein 2 (Ergic2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 2 (Ergic2)

Recombinant Mouse Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 2 (Ergic2) is a recombinant protein derived from the mouse gene encoding Ergic2. This protein plays a crucial role in the transport of proteins between the endoplasmic reticulum (ER) and the Golgi apparatus, which is essential for cellular function and protein processing. The recombinant form of Ergic2 is often used in research to study its biological functions and interactions.

Structure and Function of Ergic2

Ergic2 is a protein consisting of 377 amino acid residues. It contains two hydrophobic transmembrane domains that anchor it to the ER membrane, with its large luminal domain oriented inside the ER lumen and both N- and C-termini facing the cytosol . Ergic2 is believed to act as a chaperone molecule involved in protein trafficking between the ER and Golgi apparatus, forming complexes with other proteins like ERGIC3 and ERGIC32 .

Biological Functions and Research Findings

Ergic2 has been implicated in several biological processes, including the regulation of cell growth and the suppression of tumor formation. It has been shown to induce cell growth arrest and senescence, suppress colony formation in soft agar, and decrease the invasive potential of human prostate cancer cells . Additionally, Ergic2 and its homologs, such as ERGIC3, are crucial for the efficient intracellular transport of gap junction proteins in both Caenorhabditis elegans and mice .

Interaction Network

Ergic2 interacts with various proteins involved in cellular trafficking and quality control. Predicted functional partners include ERGIC3, SEL1L, SEL1L2, SEL1L3, COPB1, and TXNDC9 . These interactions highlight Ergic2's role in the broader context of protein trafficking and cellular homeostasis.

Research Applications

Recombinant Ergic2 is used in research to study protein trafficking mechanisms, cell signaling pathways, and potential roles in disease states such as cancer. Its recombinant form allows for controlled experiments to elucidate its functions and interactions in a laboratory setting.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ergic2; Endoplasmic reticulum-Golgi intermediate compartment protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ergic2
Target Protein Sequence
MRRLNRRKTLSLVKELDAFPKVPDSYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWM KYEYEVDKDFSSKLRINIDITVAMKCHYVGADVLDLAETMVASADGLAYEPALFDLSPQQ REWQRMLQLIQSRLQEEHSLQDVIFKSAFKSASTALPPREDDSSLTPDACRIHGHLYVNK VAGNFHITVGKAIPHPRGHAHLAALVNHDSYNFSHRIDHLSFGELVPGIINPLDGTEKIA VDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSL MVTVTEEHMPFWQFFVRLCGIIGGIFSTTGMLHGIGKFIVEIICCRFRLGSYKPVRSVPF ADGHTDNHLPLLENNTH
Uniprot No.

Target Background

Function
Potential role in transport between the endoplasmic reticulum and Golgi apparatus.
Gene References Into Functions
  1. Co-localization studies using immunohistochemistry (IHC) revealed overlapping Ergic2 and Otoferlin signals in inner hair cells and neurons of cerebral cortical layer I, suggesting Ergic2 as a potential binding partner. PMID: 22613993
  2. Hoxa2 repressed expression of its downstream target, Ptx1, within the palate. PMID: 19653318
Database Links
Protein Families
ERGIC family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasm. Nucleus. Note=Cycles between the endoplasmic reticulum and the Golgi.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.