Recombinant Mouse Endoplasmic reticulum-Golgi intermediate compartment protein 3 (Ergic3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ergic3; Erv46; Sdbcag84; Endoplasmic reticulum-Golgi intermediate compartment protein 3; Serologically defined breast cancer antigen NY-BR-84 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ergic3
Target Protein Sequence
MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKKRLDKDGVPVSSEAE RHELGKVEVTVFDPNSLDPNRCESCYGAESEDIKCCNSCEDVREAYRRRGWAFKNPDTIE QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI NMTHYIKHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF SVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG LIDSLIYHSARAIQKKIDLGKTT
Uniprot No.

Target Background

Function
Plays a potential role in endoplasmic reticulum-Golgi transport.
Database Links
Protein Families
ERGIC family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=Cycles between the endoplasmic reticulum and the Golgi.
Tissue Specificity
Expression is particularly strong in liver, kidney and brain but is almost undetectable in heart.

Q&A

What is ERGIC3 and what cellular functions does it perform?

ERGIC3 (Endoplasmic reticulum-Golgi intermediate compartment protein 3) is a protein involved in trafficking between the endoplasmic reticulum (ER) and the Golgi apparatus. It is primarily localized to the ER and cis-Golgi structures . ERGIC3 plays a crucial role in maintaining ER-Golgi trafficking, which is often elevated in cancer cells. The protein participates in cellular protein transport systems and may influence various cellular processes including proliferation and stress responses. Structurally, ERGIC3 is part of the membrane network between the transitional ER and the Golgi apparatus, contributing to vesicular-tubular trafficking that maintains cellular homeostasis .

What are the alternative names for ERGIC3 in the literature?

ERGIC3 appears in scientific literature under several alternative designations which can complicate literature searches. The protein is also known as: C20orf47 (chromosome 20 open reading frame 47), SDBCAG84 (serologically defined breast cancer antigen 84), CGI 54, Erv46, NY-BR-84, and PRO0989 . When conducting comprehensive literature reviews on this protein, researchers should include these alternative nomenclatures in their search parameters to ensure all relevant publications are identified. The diversity of names reflects the protein's discovery through different experimental approaches and in various biological contexts.

How is recombinant mouse ERGIC3 typically expressed and purified for research purposes?

Recombinant mouse ERGIC3 can be produced using several expression systems, each with distinct advantages depending on the research application. Common expression hosts include:

  • Bacterial systems (E. coli): Cost-effective and suitable for high yields, though potentially lacking mammalian post-translational modifications

  • Mammalian cell lines (HEK-293): Provides proper folding and post-translational modifications relevant to mammalian studies

  • Cell-free protein synthesis (CFPS): Allows rapid production without cellular constraints

Purification typically employs affinity chromatography utilizing tags such as His, SUMO, Myc, or DDK (DYKDDDDK). Quality assessment of recombinant ERGIC3 preparations commonly involves SDS-PAGE, Western blotting, and analytical size exclusion chromatography (SEC), with optimal preparations showing >80-90% purity . For structural or functional studies, researchers should consider whether the expression system chosen provides appropriate post-translational modifications for their specific experimental questions.

What are the most effective methods for detecting and quantifying ERGIC3 expression in mouse tissues and cell lines?

For detecting and quantifying ERGIC3 in experimental systems, researchers can employ several complementary techniques:

For protein detection:

  • Western blotting: Using specific anti-ERGIC3 antibodies (such as 6-C4 monoclonal antibody) with expected band at approximately 50 kDa

  • Immunohistochemistry (IHC): Particularly effective for tissue samples, showing subcellular localization patterns

  • Immunofluorescence: Reveals ERGIC3 localization around the Golgi apparatus and ER structures

  • ELISA: For quantitative assessment in cell or tissue lysates

For mRNA expression:

  • qRT-PCR: For quantitative measurement of ERGIC3 transcripts

  • RNA-Seq: For comprehensive transcriptomic analysis

When interpreting results, consider that ERGIC3 expression varies significantly between normal and cancerous tissues. For instance, studies have shown that ERGIC3 is strongly expressed in non-small cell lung cancer (NSCLC) cells but minimally expressed in normal lung tissues . This differential expression pattern makes it a potentially valuable biomarker for certain cancer types.

How can researchers effectively knockdown ERGIC3 expression in mouse models and cell cultures?

Several approaches have proven effective for ERGIC3 knockdown in research settings:

In vitro approaches:

  • shRNA transfection: Small hairpin RNA targeting ERGIC3 (shERGIC3) has been successfully used to suppress ERGIC3 expression in cell lines like A549 human lung cancer cells

  • siRNA approaches: For transient knockdown experiments

  • CRISPR-Cas9: For generating stable knockout cell lines

In vivo approaches:

  • Non-invasive aerosol delivery: Using biocompatible carriers like glycerol propoxylate triacrylate and spermine (GPT-SPE) complexes to deliver shERGIC3 has shown efficacy in mouse models of lung cancer

When designing knockdown experiments, target sequence selection is critical. For example, in the K-ras LA1 mouse model, four target sequences were tested, with "target sequence A" demonstrating superior silencing efficiency . Verification of knockdown should employ both mRNA (qPCR) and protein (Western blot) analyses. Researchers should be aware that complete ERGIC3 knockdown might induce significant cellular stress responses that could confound experimental interpretations.

What expression systems yield the highest functional activity for recombinant mouse ERGIC3 protein?

The functional activity of recombinant mouse ERGIC3 varies significantly based on the expression system chosen:

Expression SystemTypical YieldAdvantagesLimitationsRecommended Applications
HEK-293 cellsHighProper mammalian folding and post-translational modificationsHigher cost, longer production timeFunctional assays, protein-protein interaction studies
E. coliVery highCost-effective, rapid productionPotential misfolding, lack of mammalian PTMsStructural studies, antibody production
Cell-free protein synthesisModerateRapid production, flexible reaction conditionsHigher cost, potentially lower yieldStudies requiring quick protein production

What is the significance of ERGIC3 expression in mouse cancer models, particularly lung cancer?

ERGIC3 has emerged as a critical factor in cancer models, with particular relevance to lung carcinogenesis:

In the K-ras LA1 murine model of lung cancer, ERGIC3 shows significant involvement in tumor progression. Suppression of ERGIC3 expression through shRNA delivery produced remarkable anti-tumor effects, including:

  • Significant reduction in total tumor numbers

  • Decrease in tumors larger than 1mm

  • Histological improvements with reduced adenoma and hyperplasia foci

  • No adenocarcinoma development in ERGIC3-suppressed groups

These findings parallel observations in human cancer cells, where ERGIC3 appears to promote cancer cell growth and epithelial-mesenchymal transition, correlating with poor prognosis in lung cancer patients . Mechanistically, ERGIC3 appears to influence several cancer-related pathways, including proliferation, angiogenesis, and matrix remodeling. Reduced expression of matrix metalloproteinase-9 (MMP-9), proliferating cell nuclear antigen (PCNA), vascular endothelial growth factor (VEGF), and cyclin B1 have all been documented following ERGIC3 suppression in mouse models .

How does ERGIC3 modulation affect ER stress and autophagy in experimental models?

ERGIC3 plays a significant role in regulating ER stress responses and autophagic processes:

ER stress pathways:
Knockdown of ERGIC3 leads to ER stress-induced cell death in cancer cells. This is evidenced by increased expression of ER stress markers including CHOP and IRE1α . The connection between ERGIC3 and ER stress likely stems from its role in ER-Golgi trafficking, where disruption of this protein impairs normal protein transport and processing.

Autophagic responses:
ERGIC3 suppression triggers autophagy, demonstrated by:

  • Increased LC3-II expression (a marker of autophagosome formation)

  • Decreased p62 levels (indicating active autophagic flux)

  • Observation of dilated ER and ingested organelles in autophagosomes via transmission electron microscopy (TEM)

This relationship between ERGIC3 and autophagy provides a potential mechanism for cancer cell death following ERGIC3 inhibition. The process appears to be sequential, with ER stress occurring first, followed by compensatory autophagy that, when sustained, leads to autophagic cell death. Researchers studying these pathways should consider time-course experiments to capture the dynamic relationship between these cellular processes.

What signaling pathways are influenced by ERGIC3 expression in mouse models?

Research has identified several key signaling pathways modulated by ERGIC3:

Akt signaling pathway:
One of the most significant findings is that ERGIC3 knockdown decreases Akt1 (protein kinase B) phosphorylation at both Thr308 and Ser473 residues . This effect is observed both in vitro in cell lines and in vivo in mouse lung tissues, suggesting a conserved mechanism. Since Akt signaling is central to cell survival and proliferation, this provides a mechanistic link between ERGIC3 and cancer progression.

Proliferation and cell cycle regulation:
ERGIC3 suppression decreases expression of proliferation markers including:

  • Proliferating cell nuclear antigen (PCNA)

  • Cyclin B1

Angiogenesis pathways:
Decreased vascular endothelial growth factor (VEGF) expression following ERGIC3 knockdown suggests involvement in angiogenic signaling .

Matrix remodeling:
Reduced matrix metalloproteinase-9 (MMP-9) expression indicates potential influence on extracellular matrix remodeling and cancer invasion processes .

These interconnected pathways suggest ERGIC3 functions as an upstream regulator of multiple cancer-promoting mechanisms, making it a potentially valuable therapeutic target. When designing experiments to study ERGIC3's role in these pathways, researchers should consider examining both immediate (0-24h) and delayed (24-72h) responses to capture the full spectrum of signaling effects.

How do mouse and human ERGIC3 proteins compare in structure and function?

Mouse and human ERGIC3 proteins share significant homology, though with distinct differences researchers should consider:

Functional conservation:
Both mouse and human ERGIC3 localize to the ER-Golgi intermediate compartment and perform similar cellular functions in trafficking . The mechanism by which ERGIC3 affects cancer progression appears consistent across species, with findings from mouse models showing comparable patterns to human cancer studies.

Expression patterns:
Both species show similar tissue distribution patterns, with ERGIC3 expression in specific epithelial cell types and upregulation in carcinomas . This consistency supports the translational relevance of mouse model findings.

When using mouse ERGIC3 as a model for human studies, researchers should validate key findings in human cell lines or tissues to ensure cross-species applicability. The high degree of conservation suggests that mechanistic insights from mouse studies likely have relevance to human biology and disease.

What is the relationship between miRNA regulation and ERGIC3 expression in experimental models?

Research has revealed important miRNA-mediated regulation of ERGIC3:

Several miRNAs have been identified as potential regulators of ERGIC3 expression through bioinformatic prediction and experimental validation:

miR-203a:

  • Demonstrates inverse correlation with ERGIC3 expression in non-small cell lung cancer cells

  • Lower expression of miR-203a in NSCLC cells corresponds with higher ERGIC3 expression

  • Believed to be a key regulator of ERGIC3 overexpression in cancer

miR-140-3p:

  • Shows differential expression in NSCLC cells compared to normal cells

  • May play a role in ERGIC3 regulation, though with a less clear pattern than miR-203a

miR-490-3p:

  • Involved in ERGIC3 regulation in hepatocellular carcinoma

  • Does not show significant differential expression between NSCLC and normal cells

These findings suggest that miRNA-based approaches could potentially be used to modulate ERGIC3 expression in research or therapeutic applications. For researchers studying ERGIC3 regulation, investigating these miRNA interactions may provide additional control points for experimental manipulation. When designing such experiments, combinations of multiple regulatory miRNAs may offer more robust modulation of ERGIC3 expression than single miRNA approaches.

What are the technical challenges and solutions for studying ERGIC3 protein-protein interactions?

Investigating ERGIC3 protein-protein interactions presents several technical challenges:

Common challenges and methodological solutions:

ChallengeMethodological SolutionsTechnical Considerations
Membrane protein solubilizationUse of mild detergents (DDM, CHAPS) or nanodiscsDetergent selection can affect interaction stability
Maintaining native conformationCo-immunoprecipitation with specific antibodies (e.g., 6-C4) Use multiple antibodies targeting different epitopes
Transient interactionsProximity labeling methods (BioID, APEX)Allows capture of dynamic interactions
Subcellular localization specificityFluorescence resonance energy transfer (FRET)Provides spatial context for interactions
Verification of interactionsYeast two-hybrid or split-luciferase complementationOrthogonal validation strengthens findings

When studying ERGIC3 interactions, researchers should consider the protein's subcellular localization across the ER-Golgi network. Known interaction partners include env, ERGIC1, and phosphatidylinositol 3-phosphate (pi3p) . These interactions may be context-dependent and influenced by cellular stress conditions, suggesting that comparative studies under normal and stressed conditions may yield different interaction profiles.

For optimal results, combining multiple complementary methods is recommended rather than relying on a single approach. Additionally, researchers should carefully consider whether tagged versions of ERGIC3 (with His, SUMO, or other tags) maintain native interaction capabilities when used for protein-protein interaction studies.

How can recombinant ERGIC3 be utilized in developing targeted therapies for cancer?

Recombinant ERGIC3 offers several applications in cancer therapeutic development:

Target validation and screening:
Purified recombinant ERGIC3 can serve as a tool for high-throughput screening of small molecule inhibitors or peptide-based antagonists that disrupt its function. This approach requires high-quality recombinant protein with preserved structural integrity, preferably expressed in mammalian systems .

Antibody development:
Recombinant mouse ERGIC3 has been successfully used to develop specific monoclonal antibodies, such as the 6-C4 antibody, which has demonstrated utility in cancer detection . Such antibodies could be further developed into therapeutic antibodies or antibody-drug conjugates for targeted cancer therapy.

Immunotherapy approaches:
Given the differential expression between normal and cancer tissues, ERGIC3 represents a potential tumor-associated antigen. Recombinant ERGIC3 could be used to develop cancer vaccines or to sensitize immune cells for adoptive cell therapy approaches.

Delivery system development:
Research has demonstrated that aerosol delivery of shERGIC3 using biocompatible carriers like GPT-SPE effectively suppresses lung tumorigenesis in mouse models . Similar approaches could be optimized for human applications, with recombinant ERGIC3 serving as a tool for binding studies and carrier optimization.

How does ERGIC3 inhibition compare with other ER-Golgi trafficking targets in cancer research?

ERGIC3 presents both unique advantages and challenges compared to other ER-Golgi trafficking targets:

Comparative target assessment:

TargetSpecificity for CancerMechanism of ActionAdvantagesLimitations
ERGIC3High in NSCLC, minimal expression in normal lungER stress-induced autophagy; Akt pathway inhibitionDemonstrated efficacy in mouse models; Favorable therapeutic windowExpressed in some normal epithelial cells
COPE (coatomer protein complex)ModerateDirectly inhibits protein traffickingWell-characterized mechanismEssential for normal cell function
Sec61 complexVariableBlocks protein translocation into ERPotent anti-proliferative effectsSignificant toxicity concerns
GRASP55/65Moderate to highDisrupts Golgi structureSynergizes with chemotherapyComplex regulation

Mechanistic distinctions:
ERGIC3 inhibition appears to work through a combination of ER stress induction and suppression of Akt signaling , potentially offering more cancer-specific effects than general trafficking inhibitors. Additionally, ERGIC3 suppression affects multiple cancer-promoting processes simultaneously, including proliferation, angiogenesis, and matrix remodeling .

Combinatorial approaches: ERGIC3 inhibition might be particularly effective when combined with other therapies. For instance, since ERGIC3 knockdown induces ER stress, combination with other ER stress-inducing agents might produce synergistic effects. Similarly, given its effect on Akt signaling, combination with PI3K/mTOR pathway inhibitors might enhance therapeutic efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.