Recombinant Mouse Ephrin-B1 (Efnb1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Ephrin-B1 (Efnb1)

Recombinant Mouse Ephrin-B1 is a soluble or membrane-bound protein produced via heterologous expression systems, typically in HEK293 cells . It belongs to the Ephrin-B family of ligands that interact with Eph receptors to regulate cell migration, adhesion, and tissue patterning. Key features include:

  • Sequence: Lys30-Ser229 or Met1-Ser229 (construct-dependent) .

  • Tags: C-terminal Fc (human IgG1) or His tags for purification and detection .

  • Molecular Weight: Calculated 23.3–49.8 kDa; observed 33–80 kDa due to glycosylation .

This recombinant protein serves as a critical tool for studying Ephrin-B1’s role in developmental processes, bone metabolism, and cancer.

Biological Interactions

Ephrin-B1 binds EphB receptors (e.g., EphB2, EphB3) to induce forward signaling (receptor activation) and reverse signaling (ligand-mediated signaling) . Reverse signaling requires the PDZ-binding domain for interactions with intracellular adaptors .

Key Research Findings

Study FocusFindings
Bone Development - Transgenic overexpression → increased trabecular bone volume, thickness, and mineralization.
- Enhanced osteoblast differentiation (osterix, collagen 1A1 upregulation).
- Reduced osteoclast activity via EphB2-Fc binding inhibition.
Neural Crest Migration - Ephrin-B1 deficiency → craniofacial defects, skeletal abnormalities.
- PDZ domain required for reverse signaling in neural crest cells.
Cancer Progression - Upregulated in atherosclerotic plaques, macrophages, and T cells.
- Promotes tumorigenesis through EphB receptor interactions.

Mechanistic Insights:

  • Bone Metabolism: Ephrin-B1 overexpression in bone cells sensitizes the skeleton to mechanical loading, enhancing bone formation .

  • Developmental Biology: Ephrin-B1 regulates neural crest migration and survival, with defects linked to cleft palate and middle ear abnormalities .

Product Comparison

SupplierTagsFormulationActivity Validated?
MS Biotech Fc & HisLyophilized with trehaloseNo
R&D Systems FcPBSNo
Avantor HisLyophilizedYes (ELISA assay)

Applications:

  • MS Biotech: Suitable for biochemical assays requiring dual tags .

  • R&D Systems: BSA-free formulations for applications sensitive to carrier proteins .

  • Avantor: Validated for EphB3 binding in ELISA, ideal for receptor interaction studies .

Experimental Uses

  1. Bone Research:

    • Studying osteoblast-osteoclast interactions and mechanical loading responses .

    • Assessing therapeutic targets for osteoporosis or bone regeneration.

  2. Developmental Biology:

    • Investigating neural crest migration and craniofacial development .

    • Modeling skeletal defects in Ephrin-B1-deficient embryos.

  3. Cancer Research:

    • Exploring Ephrin-B1’s role in tumor angiogenesis and metastasis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Efnb1; Epl2; Eplg2; Lerk2; Stra1; Ephrin-B1; CEK5 receptor ligand; CEK5-L; EFL-3; ELK ligand; ELK-L; EPH-related receptor tyrosine kinase ligand 2; LERK-2; Stimulated by retinoic acid gene 1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-345
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Efnb1
Target Protein Sequence
ATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDSDSFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Uniprot No.

Target Background

Function
Ephrin-B1 is a cell surface transmembrane ligand for Eph receptors. Eph receptors are a family of receptor tyrosine kinases crucial for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Binding to Eph receptors on adjacent cells leads to contact-dependent bidirectional signaling between neighboring cells. Ephrin-B1 exhibits high affinity for the receptor tyrosine kinase EPHB1/ELK and can also bind to EPHB2 and EPHB3. It interacts with and induces the collapse of commissural axons/growth cones in vitro, potentially playing a role in regulating the orientation of longitudinally projecting axons.
Gene References Into Functions
  1. Lymphomas with low UTX expression exhibit high levels of Efnb1, leading to significantly poor survival. PMID: 30006524
  2. Expression of EFNB1 and EFNB2 is implicated in Th cell differentiation and migration to inflammatory sites in both EAE and MS. PMID: 27039370
  3. Germinal center (GC)-expressed ephrin B1 (EFNB1) repulsively inhibits T cell to B cell adhesion and GC follicular T helper retention by signaling through TFH-expressed EPHB6 receptor. Simultaneously, EFNB1 promotes interleukin-21 production from GC TFH cells by signaling predominantly through EPHB4. PMID: 28408722
  4. These observations highlight the importance of ephrinB1 signaling between cells of the skeleton, crucial for endochondral ossification. PMID: 27622886
  5. Using ephrin-B (EfnB1/B2/B3) conditional triple mutant (TM(lz)) mice, a study reports an autonomous receptor-like role for ephrin-B reverse signaling in the tangential migration of interneurons into the neocortex. PMID: 28947178
  6. These findings suggest a novel mechanism of ephrin-Eph signaling independent of direct cell contact and proteolytic cleavage, implying the involvement of EphB2(+) extracellular vesicles in neural development and synapse physiology. PMID: 27354374
  7. Ephrin-B1-mediated cell segregation occurs in the early neuroepithelium. PMID: 27810913
  8. Results indicate that ephrin-B1 signaling is involved in astrocyte-mediated remodeling of excitatory synapses following injury, potentially achieved through ephrin-B1-mediated regulation of STAT3 signaling in astrocytes. PMID: 26928051
  9. Conditional deletion of ephrinB1 and/or ephrinB2 in either thymocytes or thymic epithelial cells alters the organization of thymic medulla and favors the appearance of thymic epithelial cysts. PMID: 25417117
  10. Efnb1 and Efnb2 in T cells are essential for pathogenic antibody production and T cell migration to inflamed paws in mice with collagen-induced arthritis. PMID: 25779027
  11. EphB2 and ephrin-B1 may participate in epithelial boundary formation at the squamocolumnar junction. PMID: 23881165
  12. EFNB1 contributes to the suppression of adipose inflammatory response. In obesity, reduced adipose EFNB1 may accelerate the vicious cycle involved in adipose tissue inflammation. PMID: 24098442
  13. Overexpression of ephrin B1 in bone cells enhances bone mass. PMID: 23874863
  14. These findings highlight the complex role of Eph:ephrin signaling in the development of the sensory-motor circuit innervating the limb. PMID: 24056079
  15. This study demonstrated that ephrin-B1 inhibits nonradial migration of pyramidal neurons, thus controlling the pattern of cortical columns. PMID: 24050402
  16. Ephrin-B1 and ephrin-B2 expressed on thymocytes play an autonomous role in T cell development, and when expressed on thymic epithelial cells (TECs), their nonautonomous roles partially overlap. PMID: 23408838
  17. Results indicate that Efnb1 acts as a negative regulator of smooth muscle cell (VSMC) contractility and blood pressure (BP). PMID: 22393061
  18. Myeloid lineage-produced ephrin B1 is a negative regulator of bone resorption. PMID: 22403721
  19. The function of EFNB1 in the T cell compartment could be compensated by other members of the EFN family, suggesting that such redundancy safeguards the pivotal roles of EFNB1 in T cell development and function. PMID: 22182253
  20. Ephrin-B1 is essential for cardiac tissue architecture cohesion by stabilizing the adult cardiomyocytes morphology through regulation of its lateral membrane. PMID: 22302788
  21. Efnb1 and Efnb2 proteins regulate thymocyte development, peripheral T cell differentiation, and antiviral immune responses, and are crucial for interleukin-6 (IL-6) signaling. PMID: 21976681
  22. Ephrin-B1 mediates ventral-temporal retinal ganglion cells axon mapping within the superior colliculus. PMID: 21847105
  23. Animals lacking ephrin-B1 replicate the loss of the receptor and demonstrate that this molecule acts as the ligand to stimulate EphB2 forward signaling and direct migration of the neural progenitors. PMID: 21832177
  24. Data report that the expression of ephrin-B1 is controlled by a feedback loop involving posttranscriptional regulatory mechanisms and miR-124. PMID: 20308325
  25. A study investigated the involvement of NHERF1 and TAZ in mediating the effects of the ephrin B1 ligand on osteoblast function. PMID: 19995908
  26. GST fusion proteins of ephrin B1 cytoplasmic domain were phosphorylated by a src-family kinase, activated by the ephrin B2 receptor ectodomain fused to human IgG Fc. PMID: 11983165
  27. Findings suggest that PDZ interactions in the postsynaptic neuron and trans-synaptic interactions between postsynaptic EphB receptors and presynaptic B-ephrins are necessary for the induction of mossy fiber LTP. PMID: 12052960
  28. EphB1/Fc induced endothelial ephrin-B1 tyrosine phosphorylation, migration and integrin-mediated attachment, and promoted neovascularization in vivo, in a mouse corneal micropocket assay. PMID: 12118063
  29. A study reports a novel reverse signaling pathway transduced by ephrin-B1, independent of tyrosine phosphorylation but involving the activation of JNK kinase, leading to changes in cell morphology. PMID: 12709432
  30. Data report that targeted inactivation of the Eph receptor ligand ephrinB1 in mouse caused perinatal lethality, edema, defective body wall closure, and skeletal abnormalities. PMID: 12919674
  31. EphB1 is found exclusively in regions of retina that give rise to the ipsilateral projection at the optic chiasm; EphB1 null mice exhibit a dramatically reduced ipsilateral projection. PMID: 12971893
  32. Data show that cell contact-induced EphB-ephrinB complexes are rapidly endocytosed during the retraction of cells and neuronal growth cones. PMID: 12973358
  33. Ephrin-B1 acts both as a ligand and as a receptor in a tissue-specific manner during embryogenesis; conditional deletion of ephrin-B1 demonstrated that ephrin-B1 acts autonomously in neural crest cells and controls their migration. PMID: 15037550
  34. EFNB1 is pivotal in T-cell-T-cell costimulation and in reducing T-cell response threshold to antigen stimulation. PMID: 15502157
  35. The ephrin-B1/EphB system may participate in lesion-induced plasticity processes in the adult mouse hippocampus. PMID: 15932593
  36. EFNB1 and EFNB1 receptors are critical in thymocyte development. PMID: 16476740
  37. Gap junction communication (GJC) is inhibited at ectopic ephrin boundaries, and ephrin-B1 interacts with connexin43 and regulates its distribution. PMID: 16968134
  38. Results support a role for Eph/ephrinB in the processes of development and selection of thymocytes as well as in the establishment of the three-dimensional organization of TEC. PMID: 17668899
  39. EphrinB1 may play a significant role in the inflammatory states of rheumatoid arthritis by affecting the population/function of T cells. PMID: 17942634
  40. Ephrin-B function is essential for the maintenance of the neural progenitor cell state, mediated by PDZ-RGS3, likely through interaction with the noncanonical G protein signaling pathway. PMID: 18541704
  41. EphrinBs may contribute significantly to peripheral sensitization, and studies show that activation of the peripheral ephrinBs/EphBs system induces hyperalgesia through a MAPKs-mediated mechanism. PMID: 18706764
  42. Ephrin-B1 is expressed on dendritic spines in the cortex, supporting a role in synaptic plasticity. However, its distribution in regions such as the hippocampus and cerebellum suggests an additional structural role at the neuron/glia interface. PMID: 18973746
  43. These results suggest that ephrinB1 plays a crucial role in LPA-induced neuropathic pain. Additionally, this study may provide a new approach to identifying unique neuropathic pain-related genes. PMID: 19111589
  44. Beta-arrestin2 inhibits osteoclastogenesis in vitro, leading to decreased bone resorption in vivo by regulating RANKL/OPG production and ephrins mRNAs. PMID: 19113915
  45. Notch signaling promotes the generation of EphrinB1-positive intestinal epithelial cells. PMID: 19332065
  46. Evidence indicates that ZHX2 & ephrin-B1 cytoplasmic domain can interact and regulate transcription; the study identifies ZHX2 as a novel regulator of neural progenitor cell maintenance and suggests a potential nuclear mechanism of ephrin-B function in the cortex. PMID: 19515908
  47. Both PDZ and phosphorylation-dependent reverse signaling by ephrin-B1 are dispensable for craniofacial and skeletal development, while PDZ-dependent reverse signaling by ephrin-B1 is essential for the formation of the corpus callosum. PMID: 19515977

Show More

Hide All

Database Links

KEGG: mmu:13641

STRING: 10090.ENSMUSP00000050716

UniGene: Mm.3374

Protein Families
Ephrin family
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft.; [Ephrin-B1 C-terminal fragment]: Cell membrane; Single-pass type I membrane protein.; [Ephrin-B1 intracellular domain]: Nucleus.
Tissue Specificity
Expressed on lateral floor plate cells, specifically on commissural axon segments that have passed through the floor plate. Expressed in cells of the retinal ganglion cell layer during retinal axon guidance to the optic disk. Expressed in myogenic progeni

Q&A

What is Mouse Ephrin-B1 and how does it differ from human Ephrin-B1?

Ephrin-B1 (Efnb1) is a member of the ephrin family of transmembrane ligands that interact with Eph receptor tyrosine kinases. Mouse Ephrin-B1 is encoded by the X-linked Efnb1 gene and shares high sequence homology with human EFNB1. Both function similarly in developmental processes, including neural crest cell migration and tissue boundary formation. The mouse ortholog is extensively used in developmental biology research due to its involvement in craniofacial and skeletal development. In both species, Ephrin-B1 contains an extracellular receptor-binding domain, a transmembrane region, and an intracellular domain with multiple tyrosine residues and a PDZ-binding motif that mediates reverse signaling .

What are the primary biological functions of Ephrin-B1 in mouse development?

Ephrin-B1 plays crucial roles in multiple developmental processes:

  • Neural crest cell migration and development of neural crest-derived tissues

  • Establishment of tissue boundaries, particularly at the developing coronal suture

  • Skeletal patterning and morphogenesis, especially in craniofacial structures

  • Formation of angiogenic capillary plexi

  • Axon guidance during nervous system development

Complete ablation of Ephrin-B1 in mice results in perinatal lethality with multiple developmental defects, including abnormalities in neural crest cell-derived tissues, incomplete body wall closure, and skeletal malformations . The molecule's importance is underscored by the observation that it acts in both a tissue-specific and stage-specific manner during embryogenesis .

How does Ephrin-B1 signaling function mechanistically?

Ephrin-B1 has the unique ability to function bidirectionally:

Forward signaling: When Ephrin-B1 binds to Eph receptors (primarily EphB receptors) on adjacent cells, it triggers activation of the receptor's tyrosine kinase activity, leading to downstream signaling cascades in the receptor-expressing cell .

Reverse signaling: Upon interaction with Eph receptors, Ephrin-B1 itself becomes phosphorylated on tyrosine residues in its cytoplasmic domain, initiating signaling within the Ephrin-B1-expressing cell. The PDZ-binding domain at the C-terminus of Ephrin-B1 is critical for this reverse signaling function .

Experiments with mice bearing mutations in the PDZ-binding domain have demonstrated that Ephrin-B1-induced reverse signaling is required in a tissue-specific manner during embryogenesis, particularly in neural crest cells .

What are the optimal conditions for working with Recombinant Mouse Ephrin-B1 in vitro?

When working with Recombinant Mouse Ephrin-B1 in vitro, researchers should consider:

Storage and handling:

  • Store lyophilized protein at -20°C to -80°C

  • Reconstituted protein should be aliquoted and stored at -80°C to avoid repeated freeze-thaw cycles

  • Working solutions should be prepared fresh before experiments

Activity assessment:

  • Functional activity can be measured by binding assays using EphB receptors (particularly EphB3)

  • Typical binding assays show linear ranges between 1.56-25 ng/ml when using properly folded protein

Application-specific considerations:

  • For cell culture experiments, use serum-free medium during treatment to avoid interference from serum components

  • For in vivo experiments, ensure endotoxin levels are below 1.0 EU per μg to prevent inflammatory responses

How can I effectively distinguish between forward and reverse signaling effects in Ephrin-B1 experiments?

Distinguishing between forward and reverse signaling requires careful experimental design:

For isolating forward signaling:

  • Use Ephrin-B1 constructs lacking the cytoplasmic domain (truncated at the transmembrane region)

  • These truncated proteins can still activate Eph receptors but cannot initiate reverse signaling

  • Compare results with full-length Ephrin-B1 to identify processes dependent on reverse signaling

For isolating reverse signaling:

  • Use point mutations in the PDZ-binding domain (as demonstrated in mouse models)

  • Engineer a form of Ephrin-B1 with modified extracellular domain that maintains the ability to cluster and activate reverse signaling but cannot bind Eph receptors

  • Use soluble EphB receptor ectodomains to trigger reverse signaling without activating forward signaling

Control experiments:

  • Include appropriate controls such as IgG-Fc fragments when using Fc-fusion proteins

  • Use phosphorylation-specific antibodies to monitor activation of forward (Eph receptor phosphorylation) versus reverse (Ephrin-B1 phosphorylation) signaling

What genotyping strategies are recommended for Ephrin-B1 mutant mouse lines?

For accurate genotyping of Ephrin-B1 mutant mice:

PCR-based genotyping:

  • Design primers flanking the mutation site or loxP sites for conditional alleles

  • For the conditional null mutation, primers can be designed to detect the presence of loxP sites and the recombined locus after Cre-mediated excision

  • For point mutations (e.g., in the PDZ domain), consider using restriction enzyme digestion if the mutation creates or destroys a restriction site

Southern blot analysis:

  • Can be used to confirm proper recombination of the locus, especially useful for detecting mosaic recombination as observed in first-generation Meox2-Cre mediated deletion

Verification of protein loss:

  • Western blot analysis of embryo lysates can confirm the absence of Ephrin-B1 protein in null animals

Special considerations for X-linked inheritance:

  • Since Efnb1 is X-linked, hemizygous males and homozygous females should be distinguished from heterozygous females

  • X-inactivation analysis at the androgen receptor (AR) locus can be performed to assess X-inactivation patterns in heterozygous females

How does mosaicism in heterozygous females affect experimental outcomes?

The X-linked nature of the Efnb1 gene creates unique experimental considerations:

Cellular mosaicism effects:

  • In heterozygous females, random X-inactivation creates a mosaic pattern of Ephrin-B1 expression

  • This mosaicism results in abnormal boundary formation between Ephrin-B1-positive and Ephrin-B1-negative cell populations

  • Ectopic EphB-EphrinB1 interactions at these boundaries lead to restricted cell movements and developmental anomalies

Phenotypic consequences:

  • Heterozygous females often exhibit more severe phenotypes than hemizygous males (paradoxical inheritance)

  • Female-specific phenotypes include polydactyly and severe craniofacial abnormalities

  • This pattern is observed in both mouse models and human craniofrontonasal syndrome (CFNS)

Experimental design implications:

  • When studying Ephrin-B1 function, both heterozygous females and hemizygous males should be analyzed separately

  • Tissue-specific mosaicism effects may vary, requiring examination of multiple tissues

  • X-inactivation analysis should be performed, although studies have not observed markedly skewed X-inactivation in either blood or cranial periosteum from females with CFNS

What is the significance of the PDZ-binding domain in Ephrin-B1 reverse signaling?

The PDZ-binding domain of Ephrin-B1 plays critical roles in development:

Molecular interactions:

  • The C-terminal PDZ-binding motif interacts with various PDZ domain-containing proteins

  • These interactions are essential for proper intracellular signaling cascade activation following Eph receptor binding

Developmental importance:

  • Mutation of the PDZ-binding domain in mice demonstrates that this domain is required for proper development of neural crest cell-derived structures

  • The PDZ domain mediates tissue-specific reverse signaling during embryogenesis

Experimental approaches to study PDZ domain function:

  • Generate mice carrying specific mutations in the PDZ-binding domain

  • Compare phenotypes between PDZ domain mutants and complete null mutants to identify PDZ-dependent processes

  • Use proteomic approaches to identify tissue-specific PDZ domain-containing proteins that interact with Ephrin-B1

  • Employ phospho-specific antibodies to analyze the effect of PDZ domain mutations on tyrosine phosphorylation of Ephrin-B1

How do Ephrin-B1/Eph interactions regulate neural crest cell migration?

Neural crest cell (NCC) migration is tightly regulated by Ephrin-B1 signaling:

Cell-autonomous requirements:

  • Conditional deletion of Ephrin-B1 specifically in NCCs using Wnt1-Cre demonstrates that Ephrin-B1 acts cell-autonomously in these cells

  • NCC-specific deletion results in cleft palate and defects in other NCC-derived tissues, such as the tympanic ring of the middle ear

Migration guidance mechanisms:

  • Ephrin-B1/Eph interactions create repulsive cues that guide migrating NCCs

  • Complementary expression patterns of Ephrins and Eph receptors establish migration pathways

  • Disruption of these interaction patterns leads to NCC migration defects and subsequent developmental abnormalities

Reverse signaling importance:

  • Studies with PDZ-binding domain mutants indicate that Ephrin-B1-induced reverse signaling is required in NCCs

  • This suggests that NCCs not only respond to Eph receptor-expressing cells but actively transduce signals via Ephrin-B1

What factors might contribute to variability in Ephrin-B1 experimental results?

Several factors can affect the reproducibility and reliability of Ephrin-B1 experiments:

Genetic background effects:

  • The penetrance of Ephrin-B1-related phenotypes varies with genetic background

  • Ephrin-B1-deficient animals show different survival rates in mixed backgrounds versus congenic backgrounds

  • When designing experiments, maintain consistent genetic backgrounds or account for background effects in analyses

Sex-specific differences:

  • Due to X-linked inheritance, males and females with Ephrin-B1 mutations show distinct phenotypes

  • Always analyze data from males and females separately

  • Consider the paradoxical inheritance pattern where heterozygous females can exhibit more severe phenotypes than hemizygous males

Developmental timing:

  • Ephrin-B1 expression and function are highly stage-specific

  • Carefully stage-match embryos for developmental studies

  • When analyzing phenotypes, consider that primary defects may lead to secondary consequences at later stages

Technical considerations:

  • Protein quality and activity of recombinant Ephrin-B1 can vary between preparations

  • Cluster Ephrin-B1 (e.g., with Fc fragments) to achieve physiologically relevant signaling

  • Use appropriate controls to distinguish specific effects from non-specific binding

How can I effectively detect and analyze Ephrin-B1 expression patterns?

Several complementary approaches can be used to detect and analyze Ephrin-B1 expression:

Immunohistochemistry/immunofluorescence:

  • Use validated antibodies against Ephrin-B1

  • In heterozygous females, mosaic expression patterns may be observed due to random X-inactivation

  • Co-staining with Eph receptors can reveal potential interaction domains

RNA in situ hybridization:

  • Whole-mount in situ hybridization can visualize Efnb1 mRNA expression patterns

  • Use digoxygenin-labeled antisense probes specific to mouse Efnb1

  • For detailed analysis, follow with cryo-sectioning (typically at 15 μm)

Western blot analysis:

  • Can confirm protein expression levels and detect post-translational modifications

  • Particularly useful for verifying knockout efficiency in mutant animals

Expression correlation analysis:

  • Changes in Ephrin-B1 expression may correlate with altered expression of Eph receptors

  • In Ephrin-B1 heterozygous limb buds, altered Ephrin-B1 expression patterns correlate with changes in EphA4 receptor distribution

What are the key experimental controls needed when working with Recombinant Mouse Ephrin-B1?

To ensure robust and reproducible results with Recombinant Mouse Ephrin-B1:

Protein quality controls:

  • Verify protein activity using binding assays with cognate Eph receptors

  • Confirm proper folding through circular dichroism or functional assays

  • Check endotoxin levels (<1.0 EU per μg) to avoid non-specific inflammatory effects

Genetic controls:

  • Include wild-type controls matched for genetic background

  • For conditional knockouts, include Cre-only controls to account for potential Cre toxicity

  • For heterozygous females, consider the mosaic expression pattern when interpreting results

  • When using point mutations (e.g., PDZ domain mutations), compare with both wild-type and null mutations

Signaling specificity controls:

  • Use soluble Fc-fused Eph receptor ectodomains to block specific interactions

  • Include scrambled peptides or inactive mutants when using peptide mimetics

  • Pre-cluster Ephrin-B1 with anti-Fc antibodies when using Ephrin-B1-Fc fusion proteins to achieve physiological activation

Dosage considerations:

  • Titrate recombinant protein to determine optimal concentrations

  • For binding studies, establish a standard curve using purified proteins (typical linear ranges for binding assays: 1.56-25 ng/ml)

How do findings from mouse Ephrin-B1 studies translate to human disease conditions?

Mouse Ephrin-B1 studies provide valuable insights into human disease mechanisms:

Craniofrontonasal syndrome (CFNS):

  • Heterozygous loss-of-function mutations in human EFNB1 cause CFNS

  • The syndrome shows paradoxically greater severity in heterozygous females than hemizygous males

  • This sexual dimorphism is recapitulated in heterozygous female mice, which show more severe phenotypes and lower viability compared to hemizygous males

Phenotypic parallels:

  • Female CFNS patients exhibit frontonasal dysplasia and coronal craniosynostosis

  • Males typically show only hypertelorism

  • Similar craniofacial and digital abnormalities are observed in Ephrin-B1 mutant mice

Mechanistic insights:

  • Mosaic expression of Ephrin-B1 in heterozygous females creates abnormal tissue boundaries

  • This mosaicism disrupts proper cell sorting and migration, particularly affecting neural crest-derived tissues

  • Understanding these mechanisms in mouse models provides potential therapeutic targets for human CFNS

What emerging technologies are advancing Ephrin-B1 research?

Recent technological advances are transforming Ephrin-B1 research:

CRISPR/Cas9 genome editing:

  • Enables precise modification of the Efnb1 gene

  • Facilitates creation of specific mutations (e.g., PDZ domain mutations) to study domain-specific functions

  • Allows rapid generation of cellular and animal models with Ephrin-B1 modifications

Single-cell technologies:

  • Single-cell RNA sequencing can reveal cell-specific responses to Ephrin-B1 signaling

  • Spatial transcriptomics can map Ephrin-B1 and Eph receptor expression patterns with unprecedented resolution

  • These approaches are particularly valuable for understanding the effects of mosaic expression in heterozygous females

Advanced imaging techniques:

  • Live imaging of Ephrin-B1-GFP fusion proteins can track cellular dynamics during development

  • Super-resolution microscopy enables visualization of Ephrin-B1 clustering and membrane organization

  • Light-sheet microscopy allows whole-embryo imaging of Ephrin-B1 expression and function in real-time

Optogenetic and chemogenetic tools:

  • Light-activated or chemically-activated Ephrin-B1 variants enable temporal control over signaling

  • These tools can help dissect the acute versus chronic effects of Ephrin-B1 signaling in specific tissues

The integration of these technologies with traditional approaches is accelerating our understanding of Ephrin-B1 biology and potential therapeutic applications for related developmental disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.