Recombinant Mouse Ephrin-B2 (Efnb2)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Biochemical Properties

Ephrin-B2, encoded by the Efnb2 gene in mice, is a 40 kDa transmembrane ligand that belongs to the larger family of ephrin proteins. Unlike the GPI-anchored Ephrin-A ligands, Ephrin-B2 contains a transmembrane domain and an intracellular signaling portion that enables bidirectional signaling capabilities . The mature mouse Ephrin-B2 protein consists of three distinct domains: a 204 amino acid extracellular domain (ECD), a 21 amino acid transmembrane segment, and an 83 amino acid cytoplasmic domain that mediates intracellular signaling .

Mouse Ephrin-B2 shares significant sequence homology with its orthologs in other species, exhibiting 97% amino acid sequence identity with human Ephrin-B2 and 98% identity with rat Ephrin-B2 . This high degree of conservation across mammalian species underscores the evolutionary importance of this protein in fundamental biological processes.

Recombinant Forms and Production

Commercially available Recombinant Mouse Ephrin-B2 is typically produced as a chimeric protein fused to an immunoglobulin Fc domain. A common formulation includes the extracellular portion of mouse Ephrin-B2 (Arg27-Ala227) fused to human IgG1 (Pro100-Lys330) with a C-terminal 6-His tag for purification purposes . The recombinant protein is often produced in mammalian expression systems to ensure proper folding and post-translational modifications.

Signaling Mechanisms and Biological Activities

Ephrin-B2 exhibits a complex signaling pattern characterized by bidirectional communication. When it binds to its cognate Eph receptors, primarily those in the EphB family, it triggers both "forward" signaling in the receptor-expressing cell and "reverse" signaling back through Ephrin-B2 itself .

Forward and Reverse Signaling

The interaction between Ephrin-B2 and EphB receptors induces tyrosine autophosphorylation of the receptors, initiating forward signaling cascades that influence cytoskeletal organization, cell adhesion, and migration . Concurrently, the binding event triggers reverse signaling through Ephrin-B2's cytoplasmic domain, which can be mediated through tyrosine phosphorylation-dependent and -independent mechanisms .

Interestingly, genetic studies using mouse models have revealed that many of Ephrin-B2's embryonic functions are executed independently of tyrosine phosphorylation. Experiments with mutant versions of Efnb2 lacking tyrosine phosphorylation sites demonstrated that a single copy of this phosphorylation-deficient mutant was sufficient to rescue the embryonic phenotypes associated with complete loss of Efnb2 . This suggests that Ephrin-B2 employs multiple signaling modalities to exert its biological effects.

Cellular Morphology and Motility Effects

Overexpression of Ephrin-B2 in endothelial cells triggers dramatic changes in cellular behavior. Studies with human umbilical vein endothelial cells (HUVECs) have demonstrated that increased Ephrin-B2 expression stimulates cellular motility and initiates cycles of contraction and respreading . Additionally, Ephrin-B2 expression enhances membrane ruffling, a process associated with cellular migration and exploration of the extracellular environment .

When endogenous Ephrin-B2 is activated by soluble, recombinant EphB4, it induces a non-repetitive cycle of cell shape changes that terminates with ligand internalization . This observation highlights the dynamic nature of Ephrin-B2 signaling and its ability to modulate cellular morphology in response to receptor binding.

Developmental Roles of Ephrin-B2

Ephrin-B2 plays critical roles during embryonic development, particularly in vascular formation, neural crest cell migration, and somite patterning.

Vascular and Lymphatic Development

Ephrin-B2 is predominantly expressed in arterial vascular and lymphatic endothelium, where it regulates angiogenesis and lymphangiogenesis . Its interaction with EphB receptors helps establish arterial-venous boundaries during vascular development. Ephrin-B2 exerts proliferative and migratory effects on endothelial cells partly by regulating the signaling activity of VEGF receptors, specifically VEGF R2 and VEGF R3 .

Neural Crest Cell Migration and Somite Development

Genetic studies in mice have revealed that loss of Ephrin-B2 leads to defects in populations of cranial and trunk neural crest cells (NCC) and disrupts somite development . Ephrin-B2 expression is restricted to the posterior half of somites, where it appears to function as a repulsive cue that guides migrating trunk neural crest cells .

The importance of Ephrin-B2 in these developmental processes is further underscored by the observation that Efnb1/Efnb2 double heterozygous embryos exhibit phenotypes in multiple neural crest cell derivatives . This suggests a degree of functional redundancy between Ephrin-B1 and Ephrin-B2 in certain developmental contexts, although each also possesses unique functions.

Neuronal Development and Synaptic Function

In the nervous system, Ephrin-B2 is expressed presynaptically on neurons where it contributes to several critical processes . It promotes:

  1. Presynaptic development

  2. EphB2 shedding

  3. Axonal growth cone collapse

  4. Neurite repulsion

  5. Regulation of inflammatory and neuropathic pain responses

These activities collectively shape neural connectivity and function throughout development and into adulthood.

Pathological Implications and Therapeutic Potential

Dysregulation of Ephrin-B2 signaling has been implicated in several pathological conditions, particularly cancer and inflammatory diseases.

Role in Cancer Progression

Ephrin-B2 is frequently upregulated in invasive cancers, where it promotes tumor cell migration, invasion, and tumor angiogenesis . In multiple myeloma, Ephrin-B2 reverse signaling mediated by endothelial cells directly regulates disease progression and treatment resistance .

Studies have demonstrated that loss of EFNB2 in multiple myeloma cells blocks proliferation and survival both in vitro and in vivo models . Conversely, overexpression of EFNB2 increases STAT5 activation, enhances cancer cell survival and proliferation, and decreases sensitivity to chemotherapy . Clinical data reveals that increased EFNB2 expression correlates with adverse-risk disease and decreased survival in multiple myeloma patients .

Viral Entry Receptor

Beyond its role in normal physiology and cancer, Ephrin-B2 functions as a cellular entry receptor for Hendra and Nipah viruses, two zoonotic pathogens that can cause fatal disease in humans and animals . This finding highlights the potential involvement of Ephrin-B2 in infectious disease processes and suggests possible therapeutic avenues for addressing these viral infections.

Therapeutic Targeting

The critical roles of Ephrin-B2 in disease processes make it an attractive target for therapeutic intervention. Research has shown that administration of an EFNB2-targeted single-chain variable fragment suppresses multiple myeloma growth in vivo . Additionally, expression of mutant EFNB2 lacking reverse signaling capacity increases cancer cell death, enhances chemosensitivity, and abolishes tumor growth in animal models .

These findings suggest that targeted inhibition of Ephrin-B2, particularly its reverse signaling capacity, may represent a promising therapeutic strategy for treating multiple myeloma and potentially other cancers where Ephrin-B2 signaling is dysregulated.

Research Applications of Recombinant Mouse Ephrin-B2

Recombinant Mouse Ephrin-B2 serves as a valuable tool in numerous biomedical research applications, including:

Bioassays

Recombinant Mouse Ephrin-B2 is widely used in bioassays to study:

  • T-cell activation mechanisms

  • Apoptosis suppression in malignant T lymphocytes

  • Cell proliferation regulation in epidermis and hair follicles

  • Sympathetic neuron growth cone collapse

  • Cellular migration and invasion in cancer models

In Vivo Applications

In vivo applications of Recombinant Mouse Ephrin-B2 include:

  • Studying myeloma bone disease and tumor growth

  • Investigating inflammatory hyperalgesia

  • Examining angiogenesis in ischemic myocardium

  • Analyzing stem cell dynamics in various tissues

  • Evaluating adult neurogenesis processes

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please include them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to collect the contents at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
Efnb2; Elf2; Epl5; Eplg5; Htkl; Lerk5; Ephrin-B2; ELF-2; EPH-related receptor tyrosine kinase ligand 5; LERK-5; HTK ligand; HTK-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-336
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Efnb2
Target Protein Sequence
RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRGGNNNGSEPSDVIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Uniprot No.

Target Background

Function
Ephrin-B2 is a cell surface transmembrane ligand that interacts with Eph receptors, a family of receptor tyrosine kinases crucial for cell migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Ephrin-B2 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling between neighboring cells. This signaling pathway is referred to as forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. Ephrin-B2 binds to receptor tyrosine kinases including EPHA4, EPHA3, and EPHB4. In collaboration with EPHB4, it plays a central role in heart morphogenesis and angiogenesis by regulating cell adhesion and migration. EPHB4-mediated forward signaling controls cellular repulsion and segregation from EFNB2-expressing cells. Ephrin-B2 may also contribute to the regulation of axonal projection orientation.
Gene References Into Functions
  1. Ti particles inhibited the production of inflammatory cytokines via bidirectional signaling. The addition of ephB4Fc inhibited osteoclast-mediated Ti particle formation through bidirectional ephrinB2/ephB4 signaling. Activation of this bidirectional signaling pathway may hold potential as a clinical treatment for osteolysis surrounding prostheses. PMID: 30015911
  2. Research findings indicate that early, but not late, post-conditioning hippocampal protein synthesis is necessary for remote memory formation. This study provides the first evidence of a potential role for EphrinB2 in neuronal plasticity within the anterior cingulate cortex. PMID: 29444449
  3. GRIP1 binds to apoER2 and EphrinB2 to induce activity-dependent AMPA receptor insertion at the synapse. PMID: 28978486
  4. Findings demonstrate a previously unrecognized role for EfnB2 as a primary regulator of hematopoiesis originating from the dorsal aorta and embryonic stem cells by controlling the emergence of hemogenic endothelial cells. During vascular development, EfnB2 is essential for the proper sorting of arterial and venous-fated endothelium into distinct arterial and venous vascular beds. PMID: 27250641
  5. Data indicate that ephrinB2 and ephrinB3 signaling are required for progenitor cell identity regulation within the ventral spinal cord. PMID: 28595615
  6. As endothelial progenitor cells (EPCs) derived from mouse bone marrow were cultured on substrates with increasing stiffness, the mRNA and protein levels of the specific arterial endothelial cell marker ephrinB2 were found to increase, while the expression of the venous marker EphB4 decreased. PMID: 28732675
  7. Male Efnb2 knockout mice exhibited reduced blood pressure. The region from amino acid 313 to 331 of EFNB2 was crucial for reverse signaling regulating VSMC contractility. PMID: 27530629
  8. This research suggests a role for ephrinB2/EphB4 signaling in maintaining neurovascular homeostasis. EphrinB2 activation promotes vascular repair mechanisms and reduces brain swelling following mild cerebral ischemia. PMID: 28254815
  9. Heterotypic or homotypic cell interactions between thymocytes and thymic epithelial cells (TECs), or between TECs and themselves, mediated by the Eph/ephrin-B2 pathway contribute to the early maturation of MTS20(+) TECs. PMID: 27060907
  10. Control of abscission requires Eph kinase activity, and Src and citron kinase (CitK) act as downstream effectors in the Eph-induced signal transduction cascade. PMID: 27551053
  11. The synergistic growth cone responses elicited by Netrin-1 and ephrin-B2 involve the potentiation of Src family kinase signaling, a common effector of both pathways. PMID: 26633881
  12. An in vivo study demonstrated, for the first time, that EFNB2 is essential for normal long bone growth and development. PMID: 26980243
  13. The role of ephrin B2 in endochondral ossification using Osx1Cre-targeted gene deletion was investigated. PMID: 26755702
  14. This study uncovered a novel cell-autonomous role for ephrinB2 in lateral motor column motoneurons. PMID: 26503288
  15. These findings suggest that ephrinB2/EphB4 signaling within the osteoblast lineage is required for the late stages of osteoblast differentiation. PMID: 23165727
  16. EfnB2 is a critical regulator of endothelial cell death and vessel pruning. This regulation is dependent on phosphotyrosine-EfnB2 signaling repressing JNK3 activity through STAT1. PMID: 25807892
  17. Disruption of cochlear signaling results in supporting cell translocation into hair cell layers. PMID: 25923646
  18. Neural crest defects in ephrin-B2 mutant mice are non-autonomous and originate from vascular defects. PMID: 26385750
  19. Mice with genetically altered cytoplasmic regions of ephrinB2 exhibit significantly altered EphB4-dependent forward signaling. PMID: 25865237
  20. Ephrin-B2 signaling plays a crucial role in the formation of pituitary stem/progenitor cell niches and pituitary organogenesis. PMID: 25480420
  21. Efnb2 expression was attenuated in Pou3f4 hemizygous null mutants compared to controls. PMID: 25299585
  22. Efnb2 conditional knockout mice exhibited defects in acute arterial dilation. Vasodilation was impaired in cremaster arterioles in response to either increased flow or ACh, and in the carotid arteries in response to increased flow. PMID: 24673722
  23. Cell-cell interactions with endothelial cells enforce quiescence and promote stem cell identity. Mechanistically, endothelial ephrinB2 and Jagged1 mediate these effects. PMID: 25283993
  24. These findings suggest that conditional inactivation of Efnb2 in early-stage embryonic ear tissues disrupted cell proliferation, cell survival, and epithelial folding at the origin of the endolymphatic epithelium. PMID: 24583262
  25. Ephrin-B2 reverse signaling mediates distal alveolar formation. PMID: 23742148
  26. Ephrin-B2 is an important regulator of PDGFRbeta endocytosis and thereby acts as a molecular switch controlling the downstream signaling activity of this receptor. PMID: 24298057
  27. EphB2 and EphB3 are involved in the control of thymic epithelial cells (TEC) survival, and the absence of these molecules causes increased apoptotic TEC. PMID: 23146940
  28. This research confirmed that ephrin-B2 protein causes co-clustering of EphB2 and glutamate receptors in spinal cord neurons. PMID: 23623938
  29. B2 expressed on astrocytes inhibited axonal growth. PMID: 23518227
  30. Ephrin-B2 could be a promoter of gliosis following brain injury. PMID: 23106883
  31. These findings highlight the importance of ephrin-B2 in establishing functional auditory circuits before experience. PMID: 23042409
  32. PDZ domain-dependent ephrinB2 reverse signaling protects against PTC rarefaction by regulating angiogenesis and vascular stability during kidney injury. PMID: 23492730
  33. Ephrin-B2 plays a role in bone development and healing through the activation of osteoblast-specific gene expression. PMID: 23129351
  34. Ephrin-B2(+) astrocytes promote neuronal differentiation of adult NSCs through juxtacrine signaling. PMID: 22983209
  35. Results suggest that EFNB2 is involved in thymocyte development; however, significant redundancy among Eph/EFN family members prevents detrimental phenotypes in the T cell compartment caused by T cell-specific EFNB2 gene null mutation. PMID: 22673212
  36. This study suggests that rapid accumulation of EphrinB2 in hippocampal CA1 neurons is involved in the behavioral and cellular modifications induced by contextual fear conditioning. PMID: 22101302
  37. Dorsal and ventral-temporal axons require ephrin-B2 reverse signaling. PMID: 21847105
  38. Both EphB2/EphB3 forward signaling and ephrin-B2 reverse signaling were shown to be required for midline fusion of the palate. PMID: 21539827
  39. These findings suggest the involvement of cell-cell EphA4 and ephrin-B2 signaling in establishing order in the developing inferior colliculus. PMID: 20886601
  40. There may be a link between vascular ephrinB2 expression and the proinflammatory activation of monocytes, which may contribute to the pathogenesis of arteriosclerosis. PMID: 21127290
  41. Data show that ephrinB4 can promote the growth of melanomas expressing the ephrin-B2 ligand by stimulating proliferation, survival, and angiogenesis. PMID: 20649938
  42. Presynaptic ephrin-B2 expression plays an important role in regulating inflammatory pain through the regulation of synaptic plasticity in the dorsal horn and is also involved in the pathogenesis of some types of neuropathic pain. PMID: 21059214
  43. This research demonstrates that bath application of ephrin-B2 induces rapid and sustained growth cone collapse and axon retraction in ventrotemporal retinal ganglion cell axons. PMID: 20629048
  44. These data suggest the relevance of non-activated EphB2 in regulating T cell progenitor migration and its modulation upon ephrin-B engagement. PMID: 20504947
  45. This result implies a neural crest (NC)-derived cell-specific role for EphB-ephrin-B2 interactions in the collective migration of the thymic rudiment during organogenesis. PMID: 20616004
  46. Results suggest that the formation of arteriovenous malformations in Notch1 gain of function mutants and ephrinB/EphB pathway loss of function mutant embryos occurs through different mechanisms. PMID: 20101599
  47. EphB2-ephrin-B2 reverse signaling is required to prevent the formation of ipsilateral VCN-MNTB projections and operates non-cell autonomously. PMID: 20660266
  48. Findings show that full VEGFR3 signaling is coupled to receptor internalization; ephrin-B2 is a key regulator of this process and controls angiogenic and lymphangiogenic growth. PMID: 20445537
  49. Ephrin-B2 reverse signaling involving PDZ interactions regulates endothelial tip cell guidance to control angiogenic sprouting and branching in physiological and pathological angiogenesis. PMID: 20445540

Show More

Hide All

Database Links
Protein Families
Ephrin family
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, adherens junction.
Tissue Specificity
Expressed in inner and outer pillar cells of the organ of Corti (at protein level). Expressed on lateral floor plate cells, specifically on commissural axon segments that have passed through the floor plate. Expressed in cells of the retinal ganglion cell

Q&A

What is the molecular structure of recombinant mouse Ephrin-B2?

Recombinant mouse Ephrin-B2 is typically produced as a chimeric protein consisting of the extracellular domain (ECD) of mouse Ephrin-B2 (amino acids Arg27-Ala227) fused to the Fc region of human IgG1 (Pro100-Lys330), often with a C-terminal 6-His tag for purification purposes. The mature mouse Ephrin-B2 consists of a 204 amino acid extracellular domain, a 21 amino acid transmembrane segment, and an 83 amino acid cytoplasmic domain . The protein shares high sequence identity with other mammalian species - 97% amino acid sequence identity with human Ephrin-B2 and 98% with rat Ephrin-B2 within the extracellular domain, making it useful for cross-species studies .

How does Ephrin-B2 signaling function in cellular communications?

Ephrin-B2 engages in bidirectional signaling with Eph receptors. When Ephrin-B2 binds to EphB receptors (primarily EphB4), it can trigger both forward signaling (receptor-expressing cell) and reverse signaling (Ephrin-B2-expressing cell). Forward signaling typically involves receptor clustering and tyrosine autophosphorylation in the receptor-expressing cell, while reverse signaling involves tyrosine phosphorylation of the Ephrin-B2 cytoplasmic domain and recruitment of SH2/SH3 domain-containing proteins . These signaling cascades regulate cell adhesion, migration, and proliferation. Interestingly, expression of one copy of a mutant version of Efnb2 that lacks tyrosine phosphorylation sites was sufficient to rescue embryonic phenotypes associated with loss of Efnb2, suggesting that many embryonic functions are mediated via forward signaling rather than reverse signaling through tyrosine phosphorylation .

What are the primary biological functions of Ephrin-B2?

Ephrin-B2 participates in numerous biological processes:

  • Vascular development: Expressed by arterial vascular and lymphatic endothelium, Ephrin-B2 regulates angiogenesis and lymphangiogenesis partly by modulating VEGF receptor signaling activity .

  • Neural development: Ephrin-B2 is expressed presynaptically on neurons where it promotes presynaptic development, EphB2 shedding, axonal growth cone collapse, and neurite repulsion .

  • Neural crest cell (NCC) migration: Acts as a repulsive cue for trunk NCC migration; genetic studies show that Efnb2 null embryos exhibit trunk NCC migration defects and somite abnormalities .

  • Immune regulation: Mediates monocyte extravasation and T-cell costimulation, with studies showing its role in T-cell activation involves a concentration-dependent switch from costimulation to inhibition .

  • Pain regulation: Involved in both inflammatory and neuropathic pain mechanisms .

How should recombinant mouse Ephrin-B2 be reconstituted and stored for optimal activity?

For optimal activity maintenance, lyophilized recombinant mouse Ephrin-B2 Fc chimera should be reconstituted at 100 μg/mL in sterile PBS. After reconstitution, the protein should be stored at temperatures recommended by the manufacturer, typically -20°C to -80°C . It's critical to avoid repeated freeze-thaw cycles as they can lead to protein denaturation and activity loss. When shipping is required, the product can be transported at ambient temperature, but upon receipt, it should be immediately stored at the recommended temperature . For long-term storage projects, it may be advisable to prepare multiple small aliquots during the initial reconstitution to minimize freeze-thaw cycles.

What experimental controls should be included when conducting functional assays with Ephrin-B2?

When designing functional assays with recombinant Ephrin-B2, several controls should be considered:

  • Fc-only control: Since Ephrin-B2 is often produced as an Fc chimera, an appropriate Fc fragment alone should be used to control for non-specific effects of the Fc portion.

  • Concentration gradients: Ephrin-B2 exhibits concentration-dependent effects, particularly in T-cell activation where it can switch from costimulation to inhibition depending on concentration . Therefore, multiple concentrations should be tested.

  • Receptor specificity controls: Include EphB receptor antagonists or blocking antibodies to confirm specificity of observed effects.

  • Biological activity validation: Before main experiments, confirm protein activity using established bioassays such as EphB receptor phosphorylation assays.

  • Genetic controls: When possible, include Efnb2 null or knock-down conditions alongside wild-type conditions to establish causality .

What are the recommended applications for recombinant mouse Ephrin-B2?

Recombinant mouse Ephrin-B2 has been successfully employed in numerous experimental applications:

  • Bioassays: Used to study effects on cell migration, proliferation, and neurite growth . For example, it has been used to examine astrocyte-produced ephrins' inhibitory effects on Schwann cell migration via VAV2 signaling .

  • Enzyme assays: Employed to study receptor kinase activation and downstream signaling pathways .

  • Co-immunoprecipitation studies: Used to identify binding partners and protein complexes in signaling cascades .

  • In vivo applications: Administered to animal models to study effects on angiogenesis, neural development, and pain regulation .

  • Cell culture experiments: Used in both adherent and suspension culture conditions to study effects on cell proliferation, differentiation, and cytokinesis .

How does Ephrin-B2 regulate neural crest cell development and migration?

Ephrin-B2 plays a critical role in neural crest cell (NCC) development and migration through several mechanisms:

  • Guidance cue function: Ephrin-B2 expression is restricted to the posterior half of somites, where it acts as a repulsive cue for trunk NCCs that express compatible Eph receptors . This expression pattern establishes migratory pathways for NCCs during development.

  • Cranial NCC population maintenance: Studies of Efnb2 null embryos revealed a general reduction in cranial NCC populations, with decreased NCC migration toward both first and second branchial arches . This depletion was accompanied by increased cell death in affected regions.

  • Tissue-specific effects: Loss of Efnb2 leads to selective reduction in NCC derivatives such as the trigeminal cranial ganglion, while non-NCC-derived neurons (e.g., mid-brain neurons) remain unaffected . This selectivity indicates that Ephrin-B2 specifically regulates NCC survival and development rather than having broad effects on all neural tissues.

  • Functional redundancy: Studies of Efnb1/Efnb2 double heterozygous mutant mice revealed phenotypes in NCC derivatives that were not observed in single mutants, suggesting partial functional redundancy between these related molecules in certain developmental contexts .

What is the role of Ephrin-B2 in vascular development and angiogenesis?

Ephrin-B2 is a critical regulator of vascular development and angiogenesis through multiple mechanisms:

  • Arterial-venous specification: Ephrin-B2 is selectively expressed in arterial endothelium, while its receptor EphB4 is predominantly expressed in venous endothelium, establishing a molecular boundary that helps define arterial-venous identity .

  • VEGF receptor modulation: Ephrin-B2 regulates the signaling activity of VEGF receptor 2 (VEGFR2) and VEGF receptor 3 (VEGFR3), key receptors in angiogenesis and lymphangiogenesis . This regulation affects endothelial cell proliferation and migration during blood vessel formation.

  • Mural cell function: Beyond endothelial cells, Ephrin-B2 is expressed by vascular mural cells that provide structural support to blood vessels. It mediates interactions between endothelial cells and supporting mural cells, which is essential for vessel maturation and stability .

  • Developmental angiogenesis: Genetic studies in mice have implicated Ephrin-B2 in blood vessel formation and cardiac development , with knockout mice exhibiting severe vascular defects.

  • Tumor angiogenesis: In pathological contexts, Ephrin-B2 is upregulated in invasive cancers where it promotes tumor angiogenesis, supporting tumor growth and metastasis .

How does Ephrin-B2 contribute to somite development and pattern formation?

Ephrin-B2 contributes to somite development and pattern formation through several mechanisms:

  • Segmental expression pattern: Ephrin-B2 expression is restricted to the posterior half of somites in mice, creating a segmental pattern that helps establish boundaries within developing somites .

  • Structural defects in null mutants: Loss of Ephrin-B2 leads to defective somite development as observed in Efnb2 null embryos . These defects occur concomitantly with trunk NCC migration abnormalities, suggesting a coordinated role in regulating both processes.

  • Tissue boundary formation: By mediating repulsive interactions between cells expressing Ephrin-B2 and those expressing EphB receptors, this signaling system helps establish and maintain boundaries between different somite compartments.

  • Forward signaling mediation: Research using phosphorylation mutant mice revealed that one copy of a mutant version of Efnb2 lacking tyrosine phosphorylation sites was sufficient to rescue somite development defects, suggesting that Ephrin-B2's role in somite patterning is primarily mediated through forward signaling rather than reverse signaling .

How is Ephrin-B2 involved in glioblastoma progression and invasion?

Ephrin-B2 plays a crucial role in glioblastoma multiforme (GBM) progression through multiple mechanisms:

  • Perivascular invasion: Ephrin-B2 drives perivascular invasion of glioblastoma cells, allowing tumor cells to use blood vessels as scaffolds for migration through brain tissue .

  • Anchorage-independent proliferation: Ephrin-B2 reverse signaling enables glioblastoma stem cells (GSCs) to proliferate independently of attachment to substrates. When Ephrin-B2 is knocked down, GSCs fail to proliferate in suspension culture and exhibit G2/M cell-cycle arrest .

  • Cytokinesis regulation: Studies showed that cells lacking Ephrin-B2 reverse signaling contain a larger proportion of binucleated cells with decondensed chromatin when grown in suspension, indicating a cytokinesis block .

  • Correlation with mesenchymal phenotype: Ephrin-B2 (EFNB2) levels correlate with mesenchymal gene expression in GBM. EFNB2 levels are highest in mesenchymal and classical GBM subtypes and correlate inversely with survival specifically in mesenchymal GBM . This is particularly significant as EFNB2 is identified as a component of the core mesenchymal gene network.

  • Tumor initiation and growth: Knockdown of EFNB2 prior to implantation abrogated tumor initiation in xenograft models, and treatment of pre-existing intracranial tumors with Ephrin-B2 blocking antibodies reduced growth and expansion .

What is the relationship between Ephrin-B2 and pain regulation?

Ephrin-B2 has been implicated in both inflammatory and neuropathic pain regulation through several mechanisms:

  • NMDA receptor modulation: Ephrin-B2 induces tyrosine phosphorylation of the NR2B subunit of NMDA receptors via Src-family kinases during inflammatory hyperalgesia . This phosphorylation increases NMDA receptor activity, which is crucial for central sensitization in pain pathways.

  • Synaptic plasticity: Presynaptic Ephrin-B2 expression on neurons contributes to synaptic development and plasticity, which can affect pain processing circuits in the spinal cord and brain .

  • Neural remodeling: Following nerve injury, Ephrin-B2 signaling may contribute to maladaptive neural remodeling that leads to persistent neuropathic pain .

  • Potential therapeutic target: The involvement of Ephrin-B2 in pain mechanisms suggests it could be a target for pain management therapies, particularly for inflammatory and neuropathic pain conditions that are often resistant to conventional analgesics.

How does Ephrin-B2 signaling affect T-cell activation and immune responses?

Ephrin-B2 signaling exhibits complex effects on T-cell activation and immune responses:

  • Concentration-dependent switch mechanism: Ephrin-B2 demonstrates a novel feedback mechanism in T-cell activation, functioning as a concentration-dependent switch from costimulation to inhibition . At lower concentrations, it provides costimulatory signals that enhance T-cell activation, while at higher concentrations, it transitions to delivering inhibitory signals.

  • Monocyte extravasation: Ephrin-B2 mediates monocyte migration from the bloodstream into tissues, an essential process in immune surveillance and inflammatory responses .

  • Anti-apoptotic functions: EphB receptors triggered by Ephrin-B2 can activate Akt signaling and suppress Fas receptor-induced apoptosis in malignant T lymphocytes . This suggests a role for Ephrin-B2 in T-cell survival during immune responses.

  • Immunomodulatory potential: The bidirectional nature of Ephrin-B2 signaling and its concentration-dependent effects suggest it could be manipulated for immunomodulatory purposes in autoimmune diseases or transplantation contexts.

What approaches can be used to target Ephrin-B2 signaling in cancer therapeutics?

Several approaches show promise for targeting Ephrin-B2 signaling in cancer therapeutics:

How can researchers manipulate Ephrin-B2 signaling to study developmental processes?

Researchers can manipulate Ephrin-B2 signaling to study developmental processes through several approaches:

  • Genetic models: Utilizing Efnb2 null embryos, tyrosine phosphorylation mutants, and double heterozygous mutants (Efnb1/Efnb2) to examine developmental phenotypes in various tissues . These models help distinguish between forward and reverse signaling contributions.

  • Lineage tracking: Combining Cre recombinase-based lineage tracking (e.g., Wnt1Cre/R26R alleles) with Ephrin-B2 manipulation to visualize effects on specific cell populations like NCCs during development .

  • Ex vivo tissue culture: Culturing developing tissues with recombinant Ephrin-B2 proteins or blocking antibodies to examine direct effects on tissue morphogenesis, cell migration, and differentiation.

  • Temporal control systems: Using inducible gene expression or protein degradation systems to manipulate Ephrin-B2 signaling at specific developmental stages to dissect time-dependent functions.

  • Domain-specific mutants: Creating mutants that selectively disrupt specific domains or interaction sites to parse the contributions of different signaling modes (e.g., mutants that specifically disrupt interactions with particular EphB receptors).

What are the challenges in interpreting contradictory findings regarding Ephrin-B2 functions across different model systems?

Researchers face several challenges when interpreting contradictory findings about Ephrin-B2 functions across different model systems:

  • Context-dependent signaling: Ephrin-B2 exhibits dramatically different effects depending on cellular context. For example, it functions as a concentration-dependent switch from costimulation to inhibition in T-cells , which may explain apparently contradictory results obtained at different concentrations or in different cell types.

  • Bidirectional signaling complexity: As Ephrin-B2 can initiate both forward signaling (through EphB receptors) and reverse signaling (through its own cytoplasmic domain), experimental setups that don't distinguish between these pathways may yield conflicting results .

  • Compensatory mechanisms: Studies in Efnb2 null embryos revealed that one copy of a phosphorylation mutant was sufficient to rescue developmental phenotypes, suggesting redundant signaling mechanisms that may mask effects in some models but not others .

  • Species differences: While the extracellular domain of mouse Ephrin-B2 shares high sequence identity with human and rat versions (97% and 98% respectively) , species-specific differences in downstream signaling components or expression patterns may contribute to discrepant findings.

  • Experimental design variations: Differences in how Ephrin-B2 is presented to cells (as soluble versus membrane-bound forms, as monomers versus clusters) can significantly affect signaling outcomes and therefore experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.