Recombinant Mouse Epidermal retinol dehydrogenase 2 (Sdr16c5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Sdr16c5; Rdhe2; Scdr9; Epidermal retinol dehydrogenase 2; EPHD-2; RDH-E2; Retinal short-chain dehydrogenase reductase 2; retSDR2; Short-chain dehydrogenase reductase 9; Short-chain dehydrogenase/reductase family 16C member 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Sdr16c5
Target Protein Sequence
MSQNLESVKNLLVFLGKSLLSVLEALLFHVISKPRKNVAGEIVLITGAGSGLGRLLALQF ARLGAVLVLWDVNKEANDETHQLAREAGAARVHAYTCDCSRREEVYRVADQVKKEVGDVS ILINNAGIVTGRNFLDCPDDLMEKSFDVNFKAHLWMYKAFLPAMIANNHGHLVCISSSAG LIGVNGLSDYCASKFAALGFAESMFIETLAKKQWGIKTTIVCPFFIKTGMFEGCTTKCPT LLPILDPEYAVRKIIDAILQEQLYLYMPKFLYFIVFLKSILPIKTGILIADYLGVFHMTE GFTGQKKKT
Uniprot No.

Target Background

Function

Recombinant Mouse Epidermal Retinol Dehydrogenase 2 (Sdr16c5) is an oxidoreductase with a strong preference for NAD. It exhibits activity in both oxidative and reductive directions, oxidizing all-trans-retinol to all-trans-retinaldehyde. No activity was observed with 11-cis-retinol or 11-cis-retinaldehyde as substrates using either NAD+/NADH or NADP+/NADPH.

Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Sdr16c5 and what is its primary physiological role?

Sdr16c5, also known as epidermal retinol dehydrogenase 2 (RDHE2), is a member of the short-chain dehydrogenase/reductase superfamily of proteins. It catalyzes the rate-limiting step in retinoic acid biosynthesis by oxidizing retinol (vitamin A) to retinaldehyde. This enzyme is primarily located in the endoplasmic reticulum and is active in both oxidation and reduction directions .

The physiological significance of Sdr16c5 lies in its contribution to retinoic acid metabolism, which regulates hundreds of genes through binding to nuclear retinoic acid receptors. This activity is essential for proper embryonic and adult tissue differentiation, development, and apoptosis. Additionally, Sdr16c5 participates in immune response regulation and energy metabolism .

How does Sdr16c5 function in retinoid metabolism compared to other retinol dehydrogenases?

Sdr16c5 functions alongside other retinol dehydrogenases in the enzymatic cascade that converts retinol to retinoic acid. While several enzymes exhibit retinol dehydrogenase activities in vitro, Sdr16c5 and Sdr16c6 (its close homolog) have been demonstrated to be essential for the oxidation of retinol to retinaldehyde in vivo .

Comparative analysis with other retinol dehydrogenases:

EnzymeSubstrate PreferenceCofactor PreferenceRelative Activity
Sdr16c5 (RDHE2)All-trans-retinolNADPHModerate
Sdr16c6 (RDHE2S)All-trans-retinolNADPHHigh (5× greater than Sdr16c5)
RDH10 (SDR16C4)All-trans-retinolNADPHigh
11-cis-RDH (RDH5)11-cis-retinolNADHigh (specific to visual cycle)

Notably, when expressed in intact cells, Sdr16c5 exhibits retinol dehydrogenase activity that results in a 3-fold increase in retinoic acid biosynthesis relative to control cells. In comparison, Sdr16c6 expression at similar protein levels results in a 15-fold increase in retinoic acid production .

What is the expression pattern of Sdr16c5 in different tissues and developmental stages?

Sdr16c5 displays a developmentally regulated and tissue-specific expression pattern. Based on the research data:

  • Highest expression: Skin (epidermis)

  • Secondary expression sites: Brain, otic vesicle, eye, and olfactory bulb

  • Developmental timing: Expression becomes detectable at tailbud stages in notochord and increases during later developmental stages

In frogs (Xenopus laevis), a single ortholog of mammalian Sdr16c5 and Sdr16c6 is expressed in notochord starting at tailbud stages and then in brain, otic vesicle, eye, and olfactory bulb at early tadpole stages (stages 36-39) .

During mouse development, Sdr16c5 and Sdr16c6 exhibit an overlapping expression pattern in later developmental stages and adulthood, which may explain functional redundancy when either gene is knocked out individually .

What are the most effective methods for expressing and purifying recombinant mouse Sdr16c5?

Based on the research protocols described in the search results, the following methodologies have proven effective:

Expression System Options:

  • Bacterial expression (E. coli):

    • Expression vector: pET19 with N-terminal His₁₀ tag

    • Host strain: E. coli BL21(DE3)

    • Purification method: Nickel-nitrilotriacetic acid affinity resin

  • Mammalian expression (HEK293 cells):

    • Expression as fusion protein with C-terminal His-tag

    • Transfection using standard transfection reagents

    • Purification via affinity chromatography

Purification Protocol (Bacterial System):

  • Transform expression construct into E. coli BL21(DE3)

  • Induce protein expression with IPTG

  • Harvest cells and lyse under native conditions

  • Purify using nickel-nitrilotriacetic acid affinity resin according to manufacturer's protocol

  • Elute with imidazole gradient

  • Confirm purity by SDS-PAGE

For antibody production, a fragment corresponding to amino acids 67–305 has been successfully used to produce polyclonal antisera with detection sensitivity of 10 ng of purified recombinant protein fragment at a 1:10,000 dilution .

What assays are most effective for measuring Sdr16c5 enzymatic activity in vitro?

Several complementary approaches have been validated for measuring Sdr16c5 activity:

1. Direct Activity Assay (Oxidation Direction):

  • Substrate: All-trans-retinol (optimally 10 μM)

  • Buffer: Typically 30 mM bis-tris-propane, pH 7.5

  • Cofactor: NAD⁺ or NADP⁺ (with preference for NADP⁺)

  • Reaction monitoring: Formation of retinaldehyde by HPLC with detection at 325 nm

  • Reaction conditions: 37°C for 1-2 hours

2. Isotope-Based Assay:

  • Labeled substrate: [15-³H]retinol

  • Detection: Scintillation counting of extracted retinaldehyde product

  • Analysis confirmation: HPLC separation of reaction products

3. Cell-Based Activity Assay:

  • Transfect cells with Sdr16c5 expression construct

  • Incubate with retinol substrate

  • Extract and quantify retinaldehyde and retinoic acid production by HPLC

  • Compare to mock-transfected control cells

When performing these assays, it is important to note that Sdr16c5 shows specificity toward all-trans-retinol, but less activity toward 13-cis-retinol. The detection limits and sensitivity of the assays depend on the specific methodology, but typical Sdr16c5 activity results in a 3-fold increase in retinoic acid biosynthesis in transfected cells .

What phenotypes are observed in Sdr16c5 knockout mice?

Sdr16c5/Sdr16c6 Double Knockout (DKO) Phenotypes:

  • Viable and fertile mice

  • Accelerated hair growth after shaving

  • Enlarged meibomian glands

  • Enlarged sebaceous glands

  • Nearly 80% reduction in retinol dehydrogenase activities in skin membrane fractions

  • Upregulation of hair-follicle stem cell genes, consistent with reduced retinoic acid signaling

The molecular basis for these phenotypes includes:

  • Altered lipid profiles in meibomian glands with abnormal accumulation of shorter chain, sebaceous-type cholesteryl esters and wax esters

  • Marked increase in biosynthesis of monounsaturated and diunsaturated meibomian-type wax esters

  • Activation of a previously dormant biosynthetic pathway producing shorter chain and more unsaturated sebaceous-type wax esters

These findings demonstrate that while not critical for survival, Sdr16c5 and Sdr16c6 together are responsible for most of the retinol dehydrogenase activity in skin and are essential for regulating the hair-follicle cycle and maintaining sebaceous and meibomian glands .

How does Sdr16c5 deficiency affect retinoid metabolism at the molecular level?

Sdr16c5 deficiency leads to specific alterations in retinoid metabolism pathways:

Biochemical Changes in Sdr16c5/Sdr16c6 DKO Mice:

  • Reduction in retinol dehydrogenase activity by approximately 10-fold in microsomal fractions from skin

  • Decrease of approximately 6-fold in mitochondrial retinol dehydrogenase activity

  • Accumulation of cis-retinoids, particularly 13-cis isomers, likely due to reduced oxidation capacity

  • Altered balance between different components of the retinoid cycle

The metabolic consequences show tissue specificity:

These metabolic changes highlight the essential role of Sdr16c5 in maintaining proper retinoid homeostasis, which impacts developmental processes and tissue-specific functions.

What are the potential implications of Sdr16c5 in cancer biology and therapeutic targeting?

Recent studies have revealed significant connections between Sdr16c5 and cancer progression:

Sdr16c5 Expression in Cancer:

  • Highly expressed in multiple tumors including pancreatic cancer (PAAD)

  • Higher expression significantly associated with poorer survival in PAAD patients

  • Also elevated in laryngeal carcinoma and colorectal cancer

Functional Effects in Cancer Cells:

  • Knockdown of Sdr16c5 inhibits pancreatic cancer cell proliferation

  • Promotes cancer cell apoptosis by repressing Bcl-2, cleaved caspase 3, and cleaved caspase 9 protein expression

  • Silencing Sdr16c5 inhibits migration of PAAD cells by interrupting epithelial–mesenchymal transition

Signaling Pathway Involvement:

  • KEGG pathway analysis indicates association with immunity

  • May participate in PAAD development through the IL-17 signaling pathway

  • Correlation between Sdr16c5 expression and immune cell subset abundance has been observed

These findings suggest that Sdr16c5 may represent a potential prognostic biomarker and therapeutic target in pancreatic cancer and possibly other malignancies. Targeting Sdr16c5 could potentially inhibit tumor growth, promote apoptosis, and reduce metastatic potential through modulation of retinoid signaling and immune responses .

How do Sdr16c5 and other retinol dehydrogenases cooperate in retinoic acid synthesis pathways?

Sdr16c5 functions within a complex enzymatic network that regulates retinoic acid synthesis:

Enzymatic Cascade:

  • Retinol (Vitamin A) → Retinaldehyde → Retinoic Acid

  • First step (Retinol → Retinaldehyde): Catalyzed by retinol dehydrogenases including Sdr16c5, Sdr16c6, and RDH10

  • Second step (Retinaldehyde → Retinoic Acid): Catalyzed by retinaldehyde dehydrogenases (RALDH1, RALDH2, RALDH3)

Cooperative Interactions and Redundancy:

  • Sdr16c5 and Sdr16c6 exhibit overlapping expression patterns, providing functional redundancy

  • RDH10 complements Sdr16c5/Sdr16c6 in generating retinaldehyde for retinoic acid biosynthesis

  • In Sdr16c5/Sdr16c6 double knockout mice, alternative pathways mediated by other dehydrogenases likely maintain basal levels of retinoic acid synthesis

The combined deletion of Sdr16c5 and Sdr16c6 results in nearly 80% reduction in retinol dehydrogenase activity in skin, indicating that these enzymes are responsible for the majority of this activity in epidermal tissue .

What are the key transcriptional mechanisms regulating Sdr16c5 expression?

While the transcriptional regulation of Sdr16c5 specifically has not been extensively characterized in the search results, insights can be drawn from related retinol dehydrogenases and retinoic acid pathway components:

Transcriptional Regulation Mechanisms:

  • Retinoic acid-dependent signaling via the Retinoic Acid Receptor (RAR)/Retinoid X Receptor (RXR) complex plays a crucial role in regulating retinol dehydrogenases

  • Sp1 transcription factor binding to GC-rich sites near the TATA box is important for related dehydrogenases

  • MAPK signaling pathways (ERK and p38) contribute to nuclear translocation of Sp1 and subsequent gene expression

For the related enzyme RALDH2, cooperative binding of Sp1 and the RAR/RXR complex to the promoter is required for GM-CSF/RA-induced expression. This suggests similar mechanisms might regulate Sdr16c5, though direct evidence is needed .

How do kinetic properties of Sdr16c5 influence its physiological function?

The kinetic properties of Sdr16c5 have significant implications for its physiological function:

Kinetic Parameters and Substrate Specificity:

  • Sdr16c5 exhibits lower catalytic activity compared to Sdr16c6

  • When expressed in intact cells, Sdr16c5 increases retinoic acid biosynthesis 3-fold relative to control cells

  • In comparison, Sdr16c6 increases retinoic acid production 15-fold at similar protein levels

Cofactor Preference:
Sdr16c5 shows preference for NADPH as a cofactor over NADH, similar to Sdr16c6. This is in contrast to other retinol dehydrogenases like 11-cis-RDH, which preferentially uses NADH .

Substrate Isomer Specificity:
Unlike some other retinol dehydrogenases, Sdr16c5 and Sdr16c6 have activity toward all-trans-retinol but limited activity toward 13-cis-retinol. This specificity affects the isomeric composition of retinoids in tissues where these enzymes are expressed, potentially explaining the accumulation of 13-cis-isomers observed in knockout models .

These kinetic properties help explain why dual inactivation of Sdr16c5 and Sdr16c6 is required to observe significant phenotypic effects, as the higher catalytic efficiency of Sdr16c6 can compensate for Sdr16c5 deficiency in single knockout models .

How can Sdr16c5 be used as a tool to study retinoic acid signaling in development?

Sdr16c5 and its manipulation provide valuable tools for studying retinoic acid signaling in developmental processes:

Experimental Approaches:

  • Gain-of-function studies:

    • Overexpression of Sdr16c5 in developing embryos leads to increased retinoic acid synthesis

    • In frog embryos, this results in posteriorization and defects resembling retinoic acid toxicity

    • Can be used to identify retinoic acid-responsive genes and developmental processes

  • Loss-of-function studies:

    • Antisense morpholino-mediated knockdown of Sdr16c5 ortholog in frogs results in:

      • Defects in anterior neural tube closure

      • Microcephaly with small eye formation

      • Disruption of somitogenesis

      • Curved body axis with bent tail

    • Higher doses induce embryonic lethality

    • These phenotypes are consistent with retinoic acid deficiency

  • Reporter systems:

    • Retinoic acid levels can be monitored using endogenous retinoic acid-sensitive genes (e.g., hoxd4)

    • Retinoic acid reporter cell lines provide quantitative assessment of retinoic acid production

  • Rescue experiments:

    • Phenotypes induced by Sdr16c5 knockdown can be rescued by exogenous retinoic acid administration

    • This confirms the specificity of the observed effects to retinoic acid deficiency

These approaches allow researchers to manipulate retinoic acid levels in specific tissues and developmental stages, providing insights into the role of retinoid signaling in various developmental processes.

What methods can be used to visualize and quantify Sdr16c5 expression patterns in tissues?

Several complementary approaches have been validated for detecting and quantifying Sdr16c5 expression:

1. mRNA Detection Methods:

  • RT-PCR and qPCR:

    • Intron-spanning PCR primers for specific detection

    • Real-time PCR with Evagreen intercalated dye-based approach

  • In situ hybridization:

    • Detects spatial expression patterns in intact tissues

    • Used to reveal expression in notochord, brain, otic vesicle, eye, and olfactory bulb

  • RNA-Seq:

    • Provides comprehensive transcriptome-wide expression data

    • Can be analyzed using two-way ANOVA approach to identify differential expression

2. Protein Detection Methods:

  • Western blotting:

    • Using rabbit polyclonal antisera raised against recombinant Sdr16c5 fragment

    • Typical working dilution: 1:5,000

    • Can detect as little as 10 ng of purified protein at 1:10,000 dilution

  • Immunohistochemistry/Immunofluorescence:

    • Reveals subcellular localization (endoplasmic reticulum)

    • Allows visualization of expression in specific cell types within tissues

3. Activity-Based Detection:

  • Enzyme activity assays:

    • Measures retinol dehydrogenase activity in tissue fractions

    • Can distinguish between microsomal and mitochondrial activities

For quantitative analysis of expression changes across different conditions or developmental stages, a combination of qPCR and Western blotting provides the most reliable results. In situ hybridization and immunohistochemistry are valuable for spatial localization studies when expression levels might be below detection limits of other methods .

What are the major challenges in working with recombinant Sdr16c5 and how can they be addressed?

Working with recombinant Sdr16c5 presents several technical challenges:

1. Solubility and Stability Issues:

  • Challenge: Sdr16c5 is a membrane-associated protein located in the endoplasmic reticulum, which can lead to solubility problems during expression and purification.

  • Solutions:

    • Express as fusion protein with solubility-enhancing tags (His-tag)

    • Use appropriate detergents during extraction and purification

    • Express protein fragments (e.g., amino acids 67–305) rather than full-length protein

2. Enzymatic Activity Preservation:

  • Challenge: Maintaining enzymatic activity during purification and storage.

  • Solutions:

    • Purify under native conditions rather than denaturing conditions

    • Include stabilizing agents (glycerol, reducing agents) in storage buffers

    • Store at -80°C in small aliquots to avoid freeze-thaw cycles

3. Substrate Handling:

  • Challenge: Retinoids are highly sensitive to light, oxygen, and heat.

  • Solutions:

    • Perform all procedures under dim red light (transmittance >560 nm)

    • Use nitrogen atmosphere when possible

    • Store retinoid solutions in amber vials at -80°C

    • Include antioxidants in reaction buffers

4. Detection and Quantification:

  • Challenge: Accurate quantification of enzymatic activity.

  • Solutions:

    • Use HPLC with diode array detection for isomer-specific analysis

    • Employ isotope-labeled substrates for increased sensitivity

    • Include appropriate controls (enzyme-free, heat-inactivated enzyme)

How can researchers distinguish between Sdr16c5 and Sdr16c6 activities in experimental systems?

Distinguishing between the activities of these closely related enzymes requires specific approaches:

1. Genetic Approaches:

  • Use single knockout models (Sdr16c5-/- or Sdr16c6-/-) to isolate the contribution of each enzyme

  • Apply gene-specific siRNA knockdown in cell culture systems

  • Employ CRISPR/Cas9 with homoeolog-specific guide RNAs

2. Biochemical Discrimination:

  • Kinetic differences:

    • Sdr16c6 exhibits approximately 5-fold higher activity than Sdr16c5 when expressed at similar levels

    • This difference in catalytic efficiency can be used to distinguish between the enzymes

3. Expression Analysis:

  • Use gene-specific primers for qPCR to quantify relative expression levels

  • Apply gene-specific probes for in situ hybridization

  • Generate enzyme-specific antibodies for Western blotting and immunohistochemistry

4. Cofactor Preference:

  • While both enzymes prefer NADPH over NADH, subtle differences in cofactor specificity can be exploited using specific assay conditions

  • Testing with pro-R versus pro-S forms of NADPH might reveal enzyme-specific preferences

When working with tissues that express both enzymes, researchers should consider using double knockout models as negative controls to confirm assay specificity .

What are the most important considerations when designing experiments to study Sdr16c5 function in vivo?

Critical considerations for in vivo studies of Sdr16c5 function include:

1. Genetic Redundancy:

  • Consideration: Single Sdr16c5 knockout produces no obvious phenotype due to functional redundancy with Sdr16c6.

  • Solution: Use double knockout models or combined knockdown approaches to observe significant phenotypic effects

2. Tissue-Specific Expression:

  • Consideration: Sdr16c5 expression varies across tissues, with highest levels in skin.

  • Solution: Focus experimental design on tissues with high expression, or use tissue-specific conditional knockout approaches

3. Developmental Timing:

  • Consideration: Expression patterns change during development.

  • Solution: Carefully select developmental stages for analysis based on known expression profiles

4. Phenotypic Analysis:

  • Consideration: Phenotypes may be subtle or visible only under specific conditions.

  • Solution: Include appropriate challenges (e.g., hair shaving to assess regrowth rate) to reveal conditional phenotypes

5. Molecular Readouts:

  • Consideration: Changes in retinoic acid signaling may not produce obvious morphological phenotypes.

  • Solution: Include molecular analyses of retinoic acid-responsive genes and quantitative assessment of retinoid metabolites

6. Experimental Controls:

  • Consideration: Proper controls are essential for interpreting phenotypes.

  • Solution: Include littermate controls, rescue experiments with exogenous retinoic acid, and pharmacological inhibitors of retinoic acid synthesis as positive controls

By addressing these considerations, researchers can design robust experiments that effectively interrogate Sdr16c5 function in vivo and avoid potential pitfalls associated with genetic redundancy and subtle phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.