Recombinant Mouse Epoxide hydrolase 4 (Ephx4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. To prioritize a specific tag, please indicate your preference.
Synonyms
Ephx4; Abhd7; Ephxrp; Epoxide hydrolase 4; Abhydrolase domain-containing protein 7; Epoxide hydrolase-related protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ephx4
Target Protein Sequence
MAPPRPPRLLPALRALLYWSLVYGYCGLCASVHLLKLLWSIGRAPAQTFRRAARANPPAC LNDPSLGTHCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRHQLREFKSEYRV VALDLRGYGESDAPAHQESYKLDCLIADIKDILDSLGYSKCVLIGHDWGGMIAWLIAVCY PEMIMKLIVINFPHPSVFTEYILRHPAQLFRSSFYYFFQIPRFPEFMFSINDFKVLKHLF TSQSTGIGRKGRQLTTEDLEAYVYVFSQPGALSGPINHYRNIFSCLPLKHHMVTTPTLLL WGEEDAFMEVEMAEVTKIYVKNYFRLTILSEGSHWLQQDQPDIVNGLIWAFLKEETRRD
Uniprot No.

Target Background

Database Links
Protein Families
AB hydrolase superfamily, Epoxide hydrolase family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What is Mouse Epoxide Hydrolase 4 (EPHX4) and what are its alternative nomenclatures?

Mouse Epoxide Hydrolase 4 (EPHX4) is a member of the epoxide hydrolase family, enzymes that catalyze the hydrolysis of epoxides to their corresponding diols. EPHX4 is also known by several alternative names including ABHD7 (Abhydrolase Domain Containing 7) and EPHXRP (Epoxide hydrolase-related protein) . The protein has been assigned the UniProt Primary Accession number Q6IE26 and the secondary accession number F8VQ47, with the UniProt entry name EPHX4_MOUSE . In biological databases, it can be found under KEGG identifier mmu:384214 and String identifier 10090.ENSMUSP00000043764 .

What are the physical and structural characteristics of recombinant EPHX4?

Recombinant Mouse EPHX4 is typically produced with a calculated molecular weight of approximately 41.3 kDa . The commercially available recombinant protein usually contains the sequence fragment spanning from Lys36 to Asp359 of the native mouse EPHX4 . When expressed recombinantly, the protein is commonly produced with an N-terminal His tag to facilitate purification and downstream applications . Structural prediction analyses suggest that EPHX4 contains a membrane anchor in its N-terminal region, indicating it is likely a membrane-associated protein rather than a soluble enzyme . This membrane association has been experimentally confirmed in subcellular localization studies .

What is the tissue expression pattern of EPHX4 in mice?

Expression analysis in mice has revealed that EPHX4 mRNA is predominantly expressed in the brain . This finding aligns with data available in expression databases, suggesting a potential neurological role for this protein . The specific neuroanatomical distribution within the brain and potential developmental regulation of expression have not been extensively characterized in the available literature. This brain-specific expression pattern distinguishes EPHX4 from other epoxide hydrolases, which may exhibit broader tissue distribution patterns, suggesting specialized functions in neural tissues.

What expression systems have been successfully used for recombinant EPHX4 production?

Multiple expression systems have been employed for recombinant EPHX4 production, with varying degrees of success. Prokaryotic expression in E. coli has been widely used as demonstrated by commercial sources of the protein . The protein produced in E. coli is typically tagged with an N-terminal His tag to facilitate purification . Insect cell expression systems have also been utilized for EPHX4 production, particularly when studying enzymatic activity . These eukaryotic expression systems may provide advantages for proper folding and post-translational modifications. Each expression system has distinct advantages: E. coli provides high yield and cost-effectiveness, while insect cells may offer more native-like protein processing capabilities.

What are the optimal conditions for reconstitution and storage of recombinant EPHX4?

For storage, recombinant EPHX4 can be kept at 2-8°C for up to one month or at -80°C for up to one year . To maintain protein stability during long-term storage, aliquoting is recommended to avoid repeated freeze/thaw cycles, which can compromise protein integrity . Stability testing through accelerated thermal degradation (37°C for 48h) has shown less than 5% loss rate for properly stored protein within its expiration date .

What analytical methods are effective for detecting EPHX4 in experimental samples?

Detection of EPHX4 in experimental samples has proven challenging. Attempts to generate specific antibodies against recombinant EPHX4 expressed in E. coli or against synthetic EPHX4 peptides have not yielded reliable immunodetection tools . As an alternative approach, liquid chromatography-tandem mass spectrometry (LC-MS/MS) based peptide analysis has been established as an effective method for the specific detection of EPHX4 in cell lysates . This technique allows for precise protein identification even in complex biological samples.

For recombinant protein quality control, SDS-PAGE and Western blotting have been validated as applicable techniques . The typical applications listed for recombinant EPHX4 include Western blotting (WB) and SDS-PAGE , making these suitable methods for confirming the presence and purity of the recombinant protein in laboratory settings.

What is known about the enzymatic activity of EPHX4 compared to other epoxide hydrolases?

The enzymatic activity of EPHX4 remains somewhat controversial. Despite structural homology to other epoxide hydrolases, extensive functional testing has yielded inconsistent results. Investigations using both radioactive-labeled and unlabeled epoxide substrates, with analysis by autoradiography and LC-MS/MS, have failed to demonstrate significant reproducible enzymatic activity of EPHX4 compared to control samples . This stands in contrast to well-characterized epoxide hydrolases like soluble epoxide hydrolase (sEH), which has established roles in metabolizing epoxyeicosatrienoic acids (EETs) and epoxyoctadecenoic acids (EpOMEs) to their corresponding diols .

The apparent lack of classical epoxide hydrolase activity raises questions about EPHX4's true physiological function. It may possess highly substrate-specific activity towards yet-unidentified epoxides, or it might serve functions beyond epoxide hydrolysis, potentially including protein-protein interactions or regulatory roles in the brain where it is predominantly expressed .

What substrates have been tested with EPHX4 and what were the outcomes?

This contrasts with other epoxide hydrolases like soluble epoxide hydrolase (sEH), which demonstrates clear activity towards substrates such as epoxyeicosatrienoic acids (EETs) and epoxyoctadecenoic acids (EpOMEs), converting them to their corresponding diols, dihydroxyeicosatrienoic acids (DHETs) and dihydroxyoctadecenoic acids (DiHOMEs) .

What experimental design considerations are critical when assessing EPHX4 enzymatic activity?

When designing experiments to assess EPHX4 enzymatic activity, several critical factors should be considered. First, the expression system choice is important - both prokaryotic (E. coli) and eukaryotic (insect cells) systems have been used, with each having potential advantages for protein folding and functionality . Second, the membrane-associated nature of EPHX4 should be taken into account, as it may influence protein solubility and access to substrates .

For substrate selection, considering the brain-specific expression of EPHX4, researchers should include neurologically relevant epoxide substrates that may not have been tested in previous studies . Additionally, varying reaction conditions including pH, temperature, cofactors, and detergents may be necessary to identify optimal conditions for EPHX4 activity.

Critically, appropriate controls must be included, such as lysates from expression systems containing empty vectors and positive controls using well-characterized epoxide hydrolases with known substrates . Detection methods should be highly sensitive, with LC-MS/MS being the current gold standard for detecting potential EPHX4-generated diols in experimental samples .

What potential physiological roles might EPHX4 serve based on its expression pattern?

The predominant expression of EPHX4 in the mouse brain suggests potential neurological functions . Epoxide metabolites of polyunsaturated fatty acids can have significant effects on neuronal function, inflammation, and signaling pathways. The presence of EPHX4 in neural tissues may indicate a role in regulating these epoxide-mediated processes specifically in the central nervous system.

The membrane association of EPHX4, confirmed through subcellular localization studies, further suggests it may be involved in processing membrane-associated or lipophilic substrates, potentially including signaling molecules or lipid mediators . Given the challenges in demonstrating classical epoxide hydrolase activity, EPHX4 might possess alternative enzymatic functions or serve as a regulatory protein interacting with other neural proteins.

Future investigations exploring the neurological phenotypes of EPHX4 knockout or overexpression models could provide valuable insights into its physiological significance. Additionally, examining EPHX4 expression and function in neurological disease models might reveal potential pathophysiological roles.

How do the structural features of recombinant EPHX4 compare to those of the native protein?

Commercially available recombinant mouse EPHX4 typically contains the sequence fragment from Lys36 to Asp359, representing most but not all of the native protein . A notable addition is the N-terminal His tag used for purification purposes . This structural difference raises questions about how closely the recombinant protein mimics the native form's activity and interactions.

Native EPHX4 appears to contain a membrane anchor at its N-terminus, which influences its subcellular localization . Depending on the expression system and construct design, recombinant versions may either preserve or alter this membrane association property. When expressed in E. coli, the protein likely lacks eukaryotic post-translational modifications that could affect folding, stability, or activity.

These considerations highlight the importance of validating findings from recombinant protein studies with investigations of the native protein in its physiological context. Strategies such as expressing full-length EPHX4 with the membrane anchor in eukaryotic systems might provide models that more closely resemble the native protein's behavior.

What technological innovations might help overcome current challenges in EPHX4 research?

Several technological innovations could potentially advance EPHX4 research beyond current limitations. CRISPR/Cas9-mediated genome editing could generate precise knockouts or modifications of the EPHX4 gene in cellular or animal models, facilitating investigation of its physiological roles . Advanced protein structure determination methods, including cryo-electron microscopy and AlphaFold-type prediction algorithms, could provide insights into EPHX4's structure-function relationships and potential substrate binding sites.

More sophisticated antibody generation approaches, such as phage display technology or synthetic antibody libraries, might overcome previous challenges in developing specific anti-EPHX4 antibodies . Additionally, proximity labeling methods like BioID or APEX could identify protein interaction partners of EPHX4 in neural tissues, providing functional context.

Activity-based protein profiling with epoxide-containing probes might reveal whether EPHX4 can interact with epoxides even if conventional hydrolase activity has not been detected. Finally, advanced metabolomics approaches comparing wild-type and EPHX4-deficient neural tissues could identify potential endogenous substrates or pathways affected by EPHX4 function.

How does EPHX4 differ from other members of the epoxide hydrolase family?

EPHX4 stands apart from other epoxide hydrolases in several significant ways. While the soluble epoxide hydrolase (sEH) has well-established roles in metabolizing epoxyeicosatrienoic acids (EETs) and epoxyoctadecenoic acids (EpOMEs) to their corresponding diols , EPHX4 has not demonstrated reproducible enzymatic activity towards tested epoxide substrates . This functional disparity suggests divergent evolutionary paths within the epoxide hydrolase family.

In terms of tissue distribution, EPHX4 shows predominant expression in the brain , whereas other epoxide hydrolases like sEH exhibit broader expression patterns across multiple tissues. The membrane association of EPHX4 through its N-terminal anchor also distinguishes it from soluble family members, potentially influencing its substrate access and cellular functions.

EPHX4 (also known as ABHD7) belongs to the α/β-hydrolase fold family, which includes not only epoxide hydrolases but also many other enzymes. Its classification as an epoxide hydrolase appears to be primarily based on sequence homology rather than demonstrated enzymatic activity, raising questions about its true functional categorization.

What can researchers learn from the methodological approaches used with other epoxide hydrolases?

The methodological approaches successfully employed with other epoxide hydrolases provide valuable insights for EPHX4 research. Studies on soluble epoxide hydrolase (sEH) have established robust protocols for expressing and purifying active enzyme, characterizing substrate specificity, and measuring kinetic parameters . These protocols could be adapted for EPHX4, with appropriate modifications to account for its membrane association.

For example, the general procedure for enantioselective hydrolysis of racemic epoxides with resting cells of E. coli expressing Sphingomonas sp. epoxide hydrolase (SpEH) involves creating a two-phase system with buffer and n-hexane containing the epoxide substrates . Similar approaches could be applied to test EPHX4 activity towards a broader range of substrates, potentially including those with higher lipophilicity that might better match its brain expression context.

The analytical methods used for detecting epoxide hydrolase activity, including HPLC analysis for quantification of enantiomeric excess (ee) and concentration , provide templates for developing sensitive assays for EPHX4. Additionally, the success in generating specific inhibitors for sEH demonstrates the potential for developing chemical tools to probe EPHX4 function, if enzymatic activity can be established.

What collaborative research approaches might accelerate understanding of EPHX4 function?

Understanding the true function of EPHX4 would benefit from multidisciplinary collaborative approaches. Combining expertise in protein biochemistry, structural biology, neuroscience, and metabolomics could provide complementary perspectives on this enigmatic protein. Researchers specializing in membrane protein expression and purification could help develop improved systems for producing active EPHX4, while structural biologists might elucidate its three-dimensional conformation and potential catalytic sites.

Neuroscientists focusing on lipid signaling in the brain could investigate potential neurological substrates and pathways involving EPHX4, given its brain-specific expression pattern . Metabolomics experts could employ untargeted approaches to identify changes in the lipidome or metabolome when EPHX4 is knocked out or overexpressed, potentially revealing its endogenous substrates.

Additionally, computational biologists could apply machine learning approaches to predict potential substrates based on structural modeling and comparison with other better-characterized enzymes. Such collaborative efforts would maximize the chances of unraveling EPHX4's true physiological role and significance in brain function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.