Recombinant Mouse Estradiol 17-beta-dehydrogenase 12 (Hsd17b12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Hsd17b12; Kik1; Very-long-chain 3-oxoacyl-CoA reductase; 17-beta-hydroxysteroid dehydrogenase 12; 17-beta-HSD 12; 3-ketoacyl-CoA reductase; KAR; Estradiol 17-beta-dehydrogenase 12; KIK-I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Hsd17b12
Target Protein Sequence
MECAPPAAGFLYWVGASTIAYLALRASYSLFRAFQVWCVGNEALVGPRLGEWAVVTGGTD GIGKAYAEELAKRGMKIVLISRSQDKLNQVSNNIKEKFNVETRTIAVDFSLDDIYDKIKT GLSGLEIGVLVNNVGMSYEYPEYFLEIPDLDNTIKKLININVLSVCKVTRLVLPGMVERS KGVILNISSASGMLPVPLLTIYSATKAFVDFFSQCLHEEYKSKGIFVQSVMPYLVATKLA KIQKPTLDKPSAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS LRNRYLKKRKKN
Uniprot No.

Target Background

Function
Recombinant Mouse Estradiol 17-beta-dehydrogenase 12 (Hsd17b12) catalyzes the second step in the four-reaction long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzyme adds two carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Its 3-ketoacyl-CoA reductase activity reduces 3-ketoacyl-CoA to 3-hydroxyacyl-CoA in each cycle, contributing to VLCFA production. These VLCFAs serve as precursors for membrane lipids and lipid mediators involved in various biological processes. Hsd17b12 may also convert estrone (E1) to estradiol (E2), playing a role in estrogen synthesis.
Gene References Into Functions
  1. Plays a crucial role in female fertility through its involvement in arachidonic acid metabolism. PMID: 27490311
  2. Hsd17b12 is essential for mouse organogenesis and embryonic survival. PMID: 20130115
Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in most tissues tested.

Q&A

What is Hsd17b12 and what are its primary functions in mouse models?

Hsd17b12 (Hydroxysteroid 17-beta dehydrogenase 12) is a multifunctional enzyme with dual roles in lipid and steroid metabolism. In mice, it primarily functions as:

  • A 3-ketoacyl-CoA reductase that catalyzes the second reaction in the long-chain fatty acid (LCFA) elongation cycle, reducing 3-ketoacyl-CoA to 3-hydroxyacyl-CoA within the endoplasmic reticulum .

  • A 17β-hydroxysteroid dehydrogenase that converts estrone (E1) to estradiol (E2) in ovarian tissue .

Research has demonstrated that Hsd17b12 is essential for both embryonic development and metabolic homeostasis in adult mice. The gene is expressed in multiple tissues, with highest expression observed in liver, followed by kidney, testis, and stomach, as demonstrated by Northern analysis .

How does mouse Hsd17b12 differ structurally from other hydroxysteroid dehydrogenases?

Mouse Hsd17b12 exhibits distinct structural characteristics compared to other hydroxysteroid dehydrogenases:

  • It has a coding region for a protein of 323 amino acid residues with a molecular weight of approximately 37,055 daltons .

  • Unlike human placental 17β-HSD, which shows B-stereospecificity in hydrogen transfer and exists as a dimer, mouse liver Hsd17b12 demonstrates A-stereospecificity and functions as a monomer .

  • Phylogenetically, mouse Hsd17b12 aligns more closely with members of the aldoketoreductase family (including rat and rabbit 20α-HSDs, rat and human 3α-HSD/dihydrodiol dehydrogenases, and bovine prostaglandin F synthase) rather than with the short-chain dehydrogenase family (which includes human 17β-HSD and carbonyl reductase) .

This structural divergence explains the enzyme's broader substrate specificity compared to other hydroxysteroid dehydrogenases.

What is the expression pattern of Hsd17b12 across different mouse tissues?

The expression profile of Hsd17b12 varies considerably across mouse tissues:

TissuemRNA ExpressionProtein Detection
LiverHighest (abundant 1.7-kb species)Strongly detected
KidneyModerateMinimal
TestisModerateMinimal
StomachModerateMinimal
OvaryPresent in granulosa cellsVariable by cycle
Adipose tissuePresentMinimal
Placenta (term)Not detectedNot detected

Northern analysis revealed a single 1.7-kilobase Hsd17b12 mRNA species in liver, kidney, testis, and stomach, with liver showing considerably more abundant expression than other tissues . In the testis, in situ hybridization studies have shown expression in germ cells (particularly spermatogonia, spermatocytes, and round spermatids) but not in Leydig cells . In ovaries, expression is primarily localized to granulosa cells .

How does Hsd17b12 contribute to fatty acid elongation at the molecular level?

Hsd17b12 functions as a critical enzyme in the long-chain fatty acid (LCFA) elongation pathway through the following mechanism:

  • It catalyzes the second of four sequential reactions in the LCFA elongation cycle, specifically reducing 3-ketoacyl-CoA to 3-hydroxyacyl-CoA .

  • This endoplasmic reticulum-bound enzymatic process facilitates the addition of two carbon atoms to the chain of long and very long-chain fatty acids (VLCFAs) per cycle .

  • This activity is essential for the production of VLCFAs of different chain lengths that serve as precursors for membrane lipids and lipid mediators involved in multiple biological processes .

What methodologies can be used to assess the dual enzymatic activities of Hsd17b12?

To assess the dual enzymatic functions of Hsd17b12, researchers can employ these methodological approaches:

For 17β-HSD activity (estrone to estradiol conversion):

  • Recombinant protein expression systems: Express Hsd17b12 in E. coli or mammalian cells and purify the protein for in vitro assays .

  • Radiometric assays: Incubate the purified enzyme or cell lysates with radiolabeled estrone ([³H]-E1) and measure conversion to estradiol using HPLC or TLC.

  • LC-MS/MS analysis: Quantify estrone and estradiol levels using sensitive mass spectrometry techniques.

  • Transfection studies: Compare estradiol production in cells overexpressing Hsd17b12 versus controls .

For 3-ketoacyl-CoA reductase activity (fatty acid elongation):

  • Microsomal preparations: Isolate microsomes from Hsd17b12-expressing cells to measure fatty acid elongation activity.

  • Lipidomics analysis: Perform comprehensive lipidomic profiling of cells or tissues with altered Hsd17b12 expression, focusing on ceramides and fatty acids of different chain lengths .

  • Metabolic labeling: Use radiolabeled acetate or palmitate to track fatty acid elongation rates.

  • Seahorse analysis: Measure changes in cellular respiration and ATP production to assess metabolic consequences of altered fatty acid metabolism .

The recombinant enzyme shows activity toward multiple substrates including androgens, estrogens, and xenobiotic compounds, reflecting its multifunctional nature .

How does Hsd17b12 deficiency impact lipid homeostasis and energy metabolism?

Hsd17b12 deficiency profoundly disrupts lipid homeostasis and energy metabolism through several mechanisms:

Systemic effects in conditional knockout mice:

  • Rapid weight loss (20% of body weight within 6 days)

  • Drastic reduction in white (75-83%) and brown (60-65%) adipose tissue

  • Reduced food and water intake

  • Development of microvesicular hepatic steatosis

  • Liver damage with elevated serum alanine aminotransferase levels (4.6-fold in males, 7.7-fold in females)

Cellular and molecular effects:

  • Altered ceramide metabolism with accumulation of shorter-chain ceramides and dihydroceramides

  • Disruption in lipid droplet formation and expansion in hepatocytes, with smaller lipid droplets predominating

  • Decreased ATP production through oxidative phosphorylation and reduced spare respiratory capacity

  • Altered unfolded protein response (UPR), including decreased CHOP expression and increased eIF2α activation

Hepatocyte-specific knockout mice show a more gradual decline in body weight and progressive development of non-alcoholic fatty liver disease (NAFLD). Importantly, these mice exhibit a defect in lipid droplet expansion, characterized by predominant microvesicular steatosis rather than macrovesicular steatosis despite increasing fat content, suggesting compromised lipid droplet fusion mechanisms .

What are the most effective strategies for generating conditional Hsd17b12 knockout mouse models?

Based on successful published research, the following strategies have proven effective for generating conditional Hsd17b12 knockout models:

Generation of floxed Hsd17b12 allele:

  • Obtain a targeting vector containing loxP sites flanking a critical exon (exon 2 has been successfully used)

  • Incorporate FRT-flanked selection markers (e.g., lacZ and neo cassettes) for screening

  • Electroporate the linearized vector into embryonic stem cells (G4 hybrid mouse embryonic stem cells have been used successfully)

  • Screen colonies using PCR with specific primers for wild-type and mutated alleles

  • Confirm proper homologous recombination by sequencing

  • Remove selection cassettes using Flp recombinase

  • Inject cells into blastocysts and transfer to pseudopregnant foster mothers

Tissue-specific and inducible knockout strategies:

  • Global inducible knockout: Cross Hsd17b12-floxed mice with Rosa26CreERT mice expressing tamoxifen-inducible Cre recombinase (HSD17B12cKO)

  • Adipocyte-specific inducible knockout: Cross Hsd17b12-floxed mice with AdipoqCreERT2 mice (aHSD17B12cKO)

  • Hepatocyte-specific knockout: Cross Hsd17b12-floxed mice with liver-specific Cre lines (LiB12cKO)

Induction protocol:

  • Daily intraperitoneal injections of 1.5 mg tamoxifen for 5 consecutive days (tamoxifen dissolved in ethanol and diluted 1:10 in rapeseed oil)

This approach allows for temporal control over gene deletion, which is especially important given the embryonic lethality of constitutive Hsd17b12 knockout .

How can researchers effectively assess the phenotypic consequences of Hsd17b12 deficiency?

To comprehensively assess phenotypic consequences of Hsd17b12 deficiency, researchers should employ these methodological approaches:

Physiological assessments:

  • Body weight monitoring (daily or weekly measurements)

  • Body composition analysis (EchoMRI to determine fat and lean mass)

  • Food and water intake monitoring

  • Behavioral assessments (especially for sickness behavior)

Biochemical analyses:

  • Serum liver enzymes (ALT, AST) to assess hepatic damage

  • Comprehensive serum chemistry panel

  • Inflammatory cytokine profiling (IL-6, IL-17, G-CSF)

  • Lipidomics analysis focusing on ceramides, dihydroceramides, and fatty acids of different chain lengths

Histological examinations:

  • H&E staining of liver and other tissues

  • Oil Red O staining for lipid droplets

  • Electron microscopy to assess ultrastructural changes in lipid droplets and organelles

  • Quantification of lipid droplet size distribution

Molecular analyses:

  • qRT-PCR for genes involved in lipid metabolism, inflammation, and ER stress

  • Western blotting for key proteins in affected pathways

  • RNA-seq for unbiased transcriptomic profiling

Metabolic assessments:

  • Seahorse analysis to measure oxygen consumption rate and extracellular acidification rate

  • Metabolic cage studies for comprehensive energy expenditure assessment

These methods have successfully revealed that Hsd17b12 deficiency leads to distinct phenotypes depending on the targeted tissue and developmental timing, ranging from embryonic lethality in constitutive knockouts to liver steatosis, inflammation, and metabolic dysregulation in conditional models .

What is the pathophysiological role of Hsd17b12 in liver disease development?

Hsd17b12 plays a critical role in hepatic lipid homeostasis, with its dysfunction leading to liver pathology through several mechanisms:

Liver-specific pathological changes:

  • Development of microvesicular steatosis rather than typical macrovesicular steatosis despite increasing fat content

  • Defect in lipid droplet expansion, characterized by numerous small lipid droplets

  • Elevated liver enzymes indicating hepatocellular damage (ALT increased 4.6-fold in males, 7.7-fold in females)

  • Progressive development of non-alcoholic fatty liver disease (NAFLD)

Molecular mechanisms underlying liver pathology:

  • Decrease in phosphatidylcholine and phosphatidylethanolamine species containing 18 and 20-carbon fatty acids, which are crucial for proper lipid droplet formation

  • Increased expression of cell death-inducing DFFA-like effector c (Cidec), suggesting compensatory mechanisms for defective lipid droplet fusion

  • Downregulation of several members of the major urinary protein family, which are altered during ER stress

  • Potential lipotoxicity due to impaired sequestration of fatty acids in lipid droplets

The hepatic phenotype is more pronounced in females than males, suggesting sex-specific regulation or consequences of Hsd17b12 deficiency . The pathology resembles certain forms of non-alcoholic fatty liver disease in humans, particularly those characterized by microvesicular steatosis, making Hsd17b12 a potential target for understanding and treating these conditions .

How does Hsd17b12 function relate to cancer pathophysiology?

The relationship between Hsd17b12 and cancer pathophysiology is complex and context-dependent:

Conflicting roles in different cancer types:

  • High 17β-HSD12 expression correlates with poor prognosis in breast and ovarian tumors in some studies

  • In contrast, a comprehensive transcriptomic analysis of 17 different cancer types across approximately 8,000 patients showed that 17β-HSD12 expression can correlate with either good or poor prognosis depending on tumor type

Cellular effects relevant to cancer progression:

  • Silencing of 17β-HSD12 in breast cancer cell lines can have divergent effects on proliferation and migration depending on the specific cell line

  • Increased proliferation and migration after 17β-HSD12 knockdown were partly mediated by metabolism of arachidonic acid towards COX2 and CYP1B1-derived eicosanoids

  • Decreased proliferation was associated with reduced ATP production through oxidative phosphorylation and could be rescued by increased glucose concentration

  • 17β-HSD12 silencing affects the unfolded protein response, decreasing CHOP expression while increasing eIF2α activation and the folding chaperone ERp44

These findings highlight the heterogeneity of breast cancer cellular responses to alterations in LCFA synthesis, suggesting that the role of Hsd17b12 in cancer is highly dependent on the specific metabolic context of the tumor cells . This complex relationship underscores the need for careful consideration when targeting this pathway for cancer therapy.

What is the relationship between Hsd17b12 and inflammatory responses?

Hsd17b12 deficiency triggers significant inflammatory responses through disruptions in lipid metabolism:

Inflammatory markers and cytokines:

  • Increased proinflammatory cytokines in conditional knockout mice, including:

    • Interleukin-6 (IL-6)

    • Interleukin-17 (IL-17)

    • Granulocyte colony-stimulating factor (G-CSF)

  • Development of sickness behavior in knockout mice, a hallmark of systemic inflammation

Mechanistic links to inflammation:

  • Altered ceramide metabolism: Accumulation of shorter-chain ceramides and dihydroceramides, which can function as inflammatory signaling molecules

  • Endoplasmic reticulum stress: Changes in unfolded protein response elements may contribute to inflammatory signaling

  • Lipotoxicity: Impaired lipid droplet formation may lead to lipotoxic effects that trigger inflammatory responses

The systemic inflammation observed in Hsd17b12-deficient mice appears to be a fatal consequence of disrupted lipid homeostasis, highlighting the essential role of this enzyme in maintaining metabolic health . This inflammatory phenotype is rapid and severe in global inducible knockout models, suggesting that Hsd17b12-dependent lipid metabolism is critical for suppressing inflammatory responses under normal conditions.

How do we reconcile the dual functions of Hsd17b12 in fatty acid elongation and steroid metabolism?

The dual functionality of Hsd17b12 presents a fascinating research challenge that can be approached through several methodologies:

Research strategies to address this question:

  • Structure-function analysis:

    • Generate site-directed mutants that selectively disrupt either the fatty acid elongation or estrogen conversion functions

    • Solve the crystal structure to identify distinct catalytic domains

    • Perform molecular docking studies with different substrates to understand binding preferences

  • Tissue-specific analyses:

    • Compare the predominant function of Hsd17b12 across tissues with different metabolic demands (liver vs. ovary)

    • Determine if tissue-specific post-translational modifications direct substrate preference

    • Identify tissue-specific binding partners that may modulate enzyme function

  • Evolutionary analysis:

    • Examine when these dual functions emerged during evolution

    • Compare enzyme specificity across species with different reproductive and metabolic requirements

    • Analyze paralogous enzymes like HSDL1 to understand functional divergence

What explains the contradictory results regarding Hsd17b12's role in cell proliferation?

The contradictory findings regarding Hsd17b12's effect on cell proliferation highlight the complexity of cellular metabolism and present several research questions:

Potential explanations for contradictory results:

  • Cell-type specific metabolic dependencies:

    • Different cell types may have varying dependencies on de novo fatty acid synthesis versus uptake

    • Cancer cell heterogeneity may explain why silencing 17β-HSD12 increases proliferation in some cells but decreases it in others

    • The metabolic flexibility of some cell lines may allow them to compensate for LCFA synthesis deficiency

  • Substrate availability and environmental conditions:

    • Media composition, particularly glucose concentration, can determine whether cells can compensate for reduced fatty acid elongation

    • Arachidonic acid availability may shift the balance between pro- and anti-proliferative signaling pathways

  • Methodological considerations:

    • Different degrees of knockdown may lead to different compensatory responses

    • Acute versus chronic deficiency may trigger distinct adaptive mechanisms

    • Different experimental endpoints and proliferation assays may capture different aspects of cellular response

As noted in one study: "Our study explains these apparently contradicting results, since we showed that the phenotype after 17β-HSD12 silencing could diverge, depending on the cellular context" . This underscores the importance of considering the specific cellular and metabolic context when interpreting studies on Hsd17b12 function, and suggests that personalized approaches may be necessary when targeting this pathway therapeutically.

What are the challenges in developing therapeutic strategies targeting Hsd17b12?

Developing therapeutic strategies targeting Hsd17b12 presents several significant challenges:

Therapeutic development challenges:

  • Essential metabolic functions:

    • Complete inhibition of Hsd17b12 is likely to cause severe adverse effects given its essential role in lipid homeostasis

    • The rapid and fatal phenotype of knockout mice suggests a narrow therapeutic window

  • Tissue-specific effects:

    • Differential expression and function across tissues makes targeting specific pathways difficult

    • Sex-specific differences in phenotypic response (e.g., more severe liver damage in females) complicate dosing strategies

    • Potential for unexpected effects in tissues reliant on local estrogen production

  • Dual functionality:

    • Targeting the fatty acid elongation function might inadvertently affect steroid metabolism and vice versa

    • Designing selective inhibitors that affect only one function remains technically challenging

  • Cancer heterogeneity:

    • Contradictory effects on cancer cell proliferation suggest that inhibition could be beneficial in some tumors but detrimental in others

    • Biomarkers would be needed to identify patients likely to respond positively

  • Complex lipid metabolism networks:

    • Compensatory pathways may limit efficacy or cause unexpected metabolic shifts

    • Long-term inhibition may lead to adaptation through upregulation of alternative pathways

Despite these challenges, partial inhibition or tissue-specific targeting of Hsd17b12 might prove valuable for certain conditions, such as estrogen-dependent cancers or specific metabolic disorders. Future research should focus on developing selective modulators rather than complete inhibitors, and on identifying patient populations most likely to benefit from such interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.