Recombinant Mouse FAD-dependent oxidoreductase domain-containing protein 1 (Foxred1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse FAD-Dependent Oxidoreductase Domain-Containing Protein 1 (Foxred1)

Recombinant Mouse FAD-dependent oxidoreductase domain-containing protein 1 (Foxred1) is a protein that contains a FAD-dependent oxidoreductase domain and is localized to the mitochondria . It is an assembly factor that promotes the correct assembly and stability of mitochondrial Complex I (CI) . Complex I, or NADH ubiquinone oxidoreductase, is a large multisubunit enzyme that catalyzes the first step in oxidative phosphorylation (OXPHOS) .

Function and Role

Foxred1 is essential for the proper function of mitochondrial complex I . It is not one of the known 45 subunits of complex I, but it is a chaperone or other factor necessary for the assembly, stability, and/or correct functioning of complex I . Bioinformatics analysis using the mouse GNF1M tissue atlas showed coexpression of FOXRED1 with other complex I subunits, implying a functional association .

Structure and Characteristics

FOXRED1 is a 53-kDa protein with a predicted mitochondrial targeting sequence of 24 amino acids . It contains an FAD-dependent oxidoreductase domain (pfam01266:DAO) . FOXRED1 belongs to the family of the D-amino acid oxidase (DAO) . It is most closely related to N-methyl amino acid dehydrogenases and plays an important role in the assembly and stability of CI .

FOXRED1 in Disease

Mutations in FOXRED1 are associated with complex I deficiency . A homozygous mutation in FOXRED1 can cause a novel disorder affecting complex I activity and stability . Silencing of FOXRED1 in human fibroblasts resulted in reduced complex I steady-state levels and activity, while lentiviral-mediated FOXRED1 transgene expression rescued complex I deficiency in the patient fibroblasts .

FOXRED1 and Cancer

FOXRED1 is an assembly factor that promotes the correct assembly and stability of mitochondrial Complex I (CI) . Alterations of mitochondrial CI might cause tumorigenesis and metastasis, but its molecular mechanisms remain unclear . Colorectal cancer patients with higher expression of FOXRED1 had a higher 3-year survival rate . Low FOXRED1 expression correlated with poor prognosis of colorectal cancer, and targeting this molecule may be a potential treatment strategy for colorectal cancer .

Research Findings

  • Lentiviral-mediated Complementation and Silencing Studies Expression of a synthetic FOXRED1 gene in patient fibroblasts, using a lentiviral vector, rescued the complex I activity to ~90% of control levels, providing evidence that the R352W missense mutation in FOXRED1 was the cause of the observed complex I deficiency in the patient .

  • Western Blot Analysis Showed a reduced steady-state level of FOXRED1 in patient fibroblasts, which increased after lentiviral transduction with wild-type FOXRED1 cDNA .

  • Protein Modeling Protein modeling using the Bacillus monomeric sarcosine oxidase structure as a template suggested that mutation of arginine to tryptophan at position 352 could impinge on the FAD-binding site .

  • mRNA Coexpression Analysis Bioinformatics analysis using the mouse GNF1M tissue atlas showed a strong positive correlation between expression of FOXRED1 and expression of known complex I subunits, implying a functional association .

Experimental Procedures

  • SDS-PAGE and BN-PAGE Immunoblot Analysis For the detection of FOXRED1 protein and the native mitochondrial complex I in patient and control cell lines, SDS-PAGE and blue native page immunoblot analysis were performed, respectively .

  • Protein Modeling The FOXRED1 (Uniprot AC: Q96CU9; ID: FXRD1_HUMAN) protein FASTA sequence was used to build a protein model generated by SWISS-MODEL .

Data tables

The following data tables represent hypothetical research findings related to FOXRED1.

Table 1: Impact of FOXRED1 Silencing on Complex I Activity in Human Fibroblasts

ConditionComplex I Activity (% of Control)
Human Control Fibroblasts100
FOXRED1 Silenced40
Scrambled Fibroblasts95

Table 2: Correlation Between FOXRED1 Expression and Clinicopathological Features of Colorectal Cancer

Clinicopathological Featurep-value
Histopathological Grading<0.05
Depth of Invasion<0.05
Lymph Node Metastasis<0.05
Distant Metastasis<0.05
TNM Stage<0.05
Age>0.05
Gender>0.05
Tumor Location>0.05

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Foxred1; FAD-dependent oxidoreductase domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-487
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Foxred1
Target Protein Sequence
MFRRALRLGLGPGLPYRGLRTRKGGFTLDWDAKVSDFKKKVDSILPGKKYEVLYDTSHLP PEQADVVIIGGGILGLSVAFWLKKLESRRGAIRVLVVEQDHTYSRASSTGPSVGGIWQQF SVPENVQLSLFSINFLRNINEYLAVVDAPPVELQFNPSGCLLLASEKDAATLENNVKMQR QEGAKVCLMSPEQLQTKFPWINVEGVALASYGLEDEGWFDAWSLLQGLRRKVQSMGVFFC QGEVTRFITSSTPMKTPTGEHVVLRRINNVHVKMDKSLEYQPVECAVVINAAGAWSGKIA ELAGVGKGLPGTLQGTKLPVEPRKRYVHLWHCPQGPGLETPLVADISGVYFRREGLGSNY LGGCSPTEEEEPDPTNLNVDHDFFQNKVWPHLVQRVPSFKTLEVQSAWAGYYDYNTFDQN GVVGPHPLVVNMYFATGFSGRGLQHAPGIGRAVAEIMLEGHFKTIDMSPFLFTRFYLGEK LQEYNIL
Uniprot No.

Target Background

Function
Essential for the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It plays a role in the mid-to-late stages of complex I assembly.
Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What are the critical functional domains and residues in Foxred1?

Foxred1 contains several crucial functional elements:

  • N-terminal mitochondrial targeting sequence: While there are differing views on whether this sequence is cleaved upon mitochondrial entry, the protein is definitively localized to mitochondria .

  • FAD-binding domain: Based on structural similarities to sarcosine oxidase (MSOX), tyrosine residues equivalent to Y410 and Y411 in the human protein are predicted to be the site of covalent FAD attachment .

  • Critical structural features: A phenyl moiety at position 359 appears to be essential for proper protein function .

  • Protein loop regions: In human FOXRED1, the region containing G307 is crucial for maintaining proper protein conformation, as mutations in this area (p.G307E) disrupt the spatial structure of the protein .

Studying these domains requires site-directed mutagenesis approaches followed by functional complementation assays in complex I-deficient cells to determine the impact on protein function.

At which stage of complex I assembly does Foxred1 function?

Foxred1 is involved in the mid-late stages of complex I assembly. Based on studies of human FOXRED1:

  • In FOXRED1-deficient cells, complex I subunits are still translated and can transiently assemble into a late-stage ~815 kDa intermediate .

  • Instead of progressing to fully assembled complex I, this intermediate breaks down to a smaller ~475 kDa subcomplex .

  • This evidence suggests Foxred1 functions after the initial assembly of individual modules but before formation of the mature ~980 kDa holoenzyme .

  • Foxred1 likely acts as a molecular chaperone that stabilizes late assembly intermediates during their transition to fully assembled complex I .

Cells lacking FOXRED1 retain only about 10% of normal complex I levels and show significantly reduced complex I activity, demonstrating the protein's critical importance in the assembly process .

How can experimental evidence of Foxred1's role in complex I assembly be demonstrated?

Multiple experimental approaches can demonstrate Foxred1's role:

  • Blue Native PAGE (BN-PAGE): This technique separates native protein complexes and can visualize:

    • Fully assembled complex I (~980 kDa)

    • Assembly intermediates (~815 kDa and ~475 kDa)

    • Reduced complex I levels in Foxred1-deficient samples

  • Complementation experiments:

    • Foxred1-deficient cells show only 9-15% residual complex I activity

    • Introduction of wild-type FOXRED1 via lentiviral vectors rescues complex I assembly specifically in these cells

    • Even FOXRED1 containing certain patient mutations can partially rescue assembly

  • Co-immunoprecipitation:

    • FOXRED1 co-immunoprecipitates with multiple complex I subunits, confirming direct interaction

  • Gene editing approaches:

    • TALEN or CRISPR-Cas9-mediated disruption of FOXRED1 creates cellular models with severely reduced complex I levels

    • These cells show growth defects in galactose media, which forces reliance on oxidative phosphorylation

MethodKey MeasurementExpected Result in Foxred1 Deficiency
BN-PAGEComplex I assemblyReduced 980 kDa complex, increased 475 kDa subcomplex
Spectrophotometric assayComplex I activity9-15% of normal activity
Oxygen consumptionCellular respirationDecreased OCR/ECAR ratio
Growth assayCellular viabilityPoor growth in galactose media
ComplementationComplex I rescueRestored complex I with wild-type Foxred1

What pathogenic variants in Foxred1 are associated with mitochondrial disease?

Several FOXRED1 mutations have been identified in patients with complex I deficiency:

  • Compound heterozygous mutations:

    • c.694C>T (p.Q232X) and c.1289A>G (p.N430S) identified in patient DT22

    • c.920G>A (p.Gly307Glu) and c.733+1G>A found in a patient with ataxia, epilepsy, and developmental delay

  • Clinical manifestations associated with these mutations include:

    • Leigh syndrome

    • Infantile-onset mitochondrial encephalopathy

    • Ataxia

    • Epilepsy

    • Psychomotor developmental delay

The genetic data consistently shows a recessive inheritance pattern, with patients typically carrying compound heterozygous variants .

What methodologies effectively assess the pathogenicity of novel Foxred1 variants?

A comprehensive approach to evaluating Foxred1 variant pathogenicity includes:

  • In silico analysis:

    • Evolutionary conservation assessment using GERP, PhyloP, and phastCons shows FOXRED1 is highly conserved through evolution

    • Pathogenicity prediction tools (MutationTaster, FATHMM, DANN, SIFT, Provean) can classify variants

    • Protein modeling to visualize structural impacts of mutations

  • Functional validation:

    • Complementation experiments introducing wild-type Foxred1 into patient fibroblasts should rescue complex I deficiency

    • Complex I activity measurements by spectrophotometric or dipstick assays

    • Blue Native PAGE to assess complex I assembly status

  • Expression studies:

    • RNA splicing analysis for variants near splice sites (as seen with c.733+1G>A variant)

    • Western blotting to assess protein expression and stability

An example validation protocol:

  • Sequence variants in patients with complex I deficiency

  • Perform in silico analysis for evolutionary conservation and pathogenicity prediction

  • Create protein models to visualize structural impacts

  • Validate using patient fibroblasts to measure complex I activity, assembly, and OCR/ECAR ratio

  • Perform rescue experiments with wild-type Foxred1

How can recombinant Foxred1 protein be optimally produced and purified?

Based on information about recombinant mouse Foxred1 production:

  • Expression systems:

    • Mammalian expression systems (e.g., HEK293) for proper folding and post-translational modifications

    • Insect cell systems using baculovirus for higher yield while maintaining proper folding

    • E. coli systems may require optimization for this eukaryotic protein

  • Key considerations for functional expression:

    • Inclusion of the FAD cofactor during purification

    • Storage in buffer containing 50% glycerol at -20°C or -80°C for extended storage

    • Tris-based buffers appear suitable for stability

  • Purification approach:

    • Affinity chromatography using appropriate tags (selection depends on specific experimental needs)

    • Size exclusion chromatography to ensure homogeneity

    • Activity verification through FAD binding and oxidoreductase assays

  • Verification of identity and purity:

    • SDS-PAGE to confirm molecular weight (~53.8 kDa)

    • Mass spectrometry to verify sequence integrity

    • Spectroscopic analysis to confirm FAD incorporation

What approaches can identify compounds that modulate Foxred1 activity?

High-throughput screening approaches to identify Foxred1 modulators:

  • Cell-based screening platforms:

    • Foxred1-deficient cells (TALEN or CRISPR-engineered) grown in galactose media

    • Readouts include cell viability, complex I activity, and mitochondrial membrane potential

  • Target-based approaches using purified recombinant Foxred1:

    • FAD binding assays (fluorescence changes upon binding)

    • Oxidoreductase activity measurements with appropriate substrates

    • Thermal shift assays to identify stabilizing compounds

  • Validation approaches:

    • Dose-response relationships in cell models

    • Confirmation in patient-derived cells harboring different FOXRED1 mutations

    • Assessment of complex I assembly by BN-PAGE following compound treatment

    • Rescue of growth defects in galactose media

  • Application in patient mutations:

    • Testing whether compounds can enhance the function of mutant Foxred1 proteins

    • This is particularly relevant since overexpression of FOXRED1 containing patient mutations was able to rescue complex I assembly in some cases

How can mouse models advance understanding of Foxred1-related diseases?

Creating and studying mouse models with Foxred1 mutations would:

  • Enable testing of tissue-specific effects:

    • Assess impact on high-energy demand tissues (brain, heart, muscle)

    • Determine developmental effects of complex I deficiency

  • Provide in vivo validation of pathogenic mechanisms:

    • Confirm assembly defects seen in cell culture

    • Correlate biochemical abnormalities with physiological phenotypes

  • Establish platforms for therapeutic testing:

    • Test interventions identified in cell-based screens

    • Evaluate long-term efficacy and tissue distribution

    • Assess developmental timing of interventions

  • Recapitulate human disease features:

    • Model spectrum of phenotypes from mild to severe based on different mutations

    • Assess progression of mitochondrial dysfunction over time

Methodologically, these models can be created using CRISPR-Cas9 gene editing to introduce patient-specific mutations or create conditional knockout models .

What is the relationship between Foxred1 function and other complex I assembly factors?

The assembly of complex I requires multiple assembly factors, of which Foxred1 is just one component. Understanding the relationship between these factors:

  • Temporal sequence of assembly:

    • FOXRED1 functions in mid-late stages of complex I assembly

    • Other assembly factors like NUBPL (IND1) function at different stages, such as incorporating Fe/S clusters

  • Experimental approaches to determine relationships:

    • Sequential immunodepletion to determine order of action

    • Double knockdown/knockout studies to identify synthetic interactions

    • BN-PAGE analysis of assembly intermediates in cells lacking different factors

  • Integrative analysis:

    • Combining data from multiple assembly factor deficiencies to construct comprehensive assembly models

    • Determining whether certain factors can compensate for others

  • Therapeutic implications:

    • Identifying which assembly step is rate-limiting could guide therapeutic approaches

    • Understanding whether overexpression of certain factors might compensate for deficiencies in others

Current evidence suggests FOXRED1 and NUBPL operate in distinct assembly steps, as they affect different assembly intermediates when deficient .

What emerging techniques may advance Foxred1 research?

Several cutting-edge approaches could significantly advance our understanding of Foxred1:

  • Cryo-electron microscopy:

    • Determine high-resolution structures of Foxred1 and its complexes with assembly intermediates

    • Visualize how disease-causing mutations affect protein structure

  • Single-cell analyses:

    • Investigate cell-to-cell variability in complex I assembly

    • Understand how heteroplasmy in mtDNA-encoded complex I subunits interacts with Foxred1 function

  • Mitochondrial-targeted gene editing:

    • Develop approaches to modify mtDNA-encoded complex I subunits

    • Create models with combinations of nuclear (Foxred1) and mitochondrial genome defects

  • Systems biology approaches:

    • Multi-omics analysis of Foxred1-deficient models

    • Network analysis to identify compensatory pathways that could be therapeutically targeted

  • High-throughput drug repositioning:

    • Screen FDA-approved compounds for those that can enhance residual complex I activity in Foxred1-deficient cells

    • Focus on compounds that can cross the blood-brain barrier for neurological phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.